CAZyme Information: MGYG000002281_01070

Basic Information

• Species: Bacteroides faecis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides faecis
• CAZyme ID: MGYG000002281_01070
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
732	MGYG000002281_3|CGC6	86355.54	5.5439

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002281	6145961	Isolate	China	Asia

• Gene Location: Start: 281329; End: 283527 Strand: +

Full Sequence      

MNHKYLYLLLLFLIVSCQRNVETGPPVLKEMCQRLFPRHAQSFLFELLTDSIDTDRFILE
SSQGKIRIKGNNRNSLAAGLNHYLKNYCHTHVSWYASETVEMPDVLPEIPQPVYIRSKCD
NRFFLNYCTFGYTMPYWKWQDWERLIDWMALNGVTMPLAITGQESIWYKVWTDMGLSDEQ
VRSYFTGPAHLPWHRMSNVDYWQSPLPQSWLKDQEELQKRILEREREFDMTPVLPAFAGH
VPAELKTIYPNAKIYQMSQWGGFDEKYRSHFIDPMDSLYSIIQRRFLEEQTKVYGTDHIY
GIDPFNEVDSPDWSEDFLANVSSKIYESIHQVDSAAQWLQMTWMFFYDKKKWTQPRIRSF
LKAVPDNKLILLDYYCDHTEIWRNTEKYYGNPYIWCYLGNFGGNTMIAGNLNDIDFKIKR
LFKEGGDNVYGLGATLEGFDVNPLMYEFVFDQAWDYPVTTDQWITNWSMCRGGNQDANII
KAWRALHQKIYTEHATCGQSVLMNARPRLTGTKSWNTNPGIHYANNDLWQIWKELLKARN
INNSDFRFDVINIGRQVLGNLFSEYRDQFTACYNRKDTTGMREWSTRMDNLLLDVDRLLS
CDATLSIGKWLQDARNCGATVSEKDYYEENARCILTVWGQQDTQLNDYANRGWGGLTRSF
YRERWKRFTDGVIAAVSEDKPFDEDKFHQDITQFEYNWTLQKDSFPIVSEEDPIQIADSL
ILKYDTYFTKAQ

Enzyme Prediction     

No EC number prediction in MGYG000002281_01070.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	63	721	5.6e-251	0.9939668174962293

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05089	NAGLU	0.0	122	454	1	331	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
pfam12972	NAGLU_C	8.72e-93	463	717	1	257	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
pfam12971	NAGLU_N	8.19e-31	29	107	4	81	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT41474.1	0.0	1	732	1	732
QQR19002.1	0.0	1	732	1	732
QMW85965.1	0.0	1	732	1	732
QQA08286.1	0.0	1	732	1	732
ANU56158.1	0.0	1	732	1	732

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XWH_A	3.42e-144	65	724	51	711	Crystalstructure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]
2VC9_A	1.95e-94	28	702	174	850	Family89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	2.26e-94	28	702	182	858	ChainA, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	2.14e-93	28	702	197	873	CpGH89(E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54802	1.66e-144	65	724	74	734	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2
Q9FNA3	6.96e-132	29	724	50	804	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000311	0.998408	0.000805	0.000162	0.000152	0.000145

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002281_01070.