CAZyme Information: MGYG000002281_01129

Basic Information

• Species: Bacteroides faecis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides faecis
• CAZyme ID: MGYG000002281_01129
• CAZy Family: CBM62
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
673		77432.33	7.5061

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002281	6145961	Isolate	China	Asia

• Gene Location: Start: 357643; End: 359664 Strand: -

Full Sequence      

MRTFTRLVSVFLLTAIGNLFFLSCSGREKNVPAVSILEIALQQAGENRVELEKVLSRYQI
DPADSLKYRAACFLIENMPYYTYYKGKQLDRYFTYYALLQKTRGLGISPQVVADSVRHMY
GPLYLDSLQSYRDIETVDSAYLCNNIEWSFKVWQEQPWGKHVSSADFCEYLLPYRIGDET
LASWRESIYQKYNPLLDSLRASGVLDKEDPIVAARCLLDSIRKGGAVFTTAVPANLPHVG
PEVVQQKTGSCRELTDFVVYVCRALGIPCAIDFMPIRGDENDSHQWVAFTDKYGTLYYHE
FPNGVSEVRKDAMCGMPKIKVYRNTFSLNRAMQEEMQKLDTAIVPLFKDPHIIDITFPYT
KDFKKELQIPKDALYKGKPRSRIAYLCASKRMDWEPVAWTDFDGKNIVFTDIQKGPVMRV
ATYERGRLRFWTDPFEINVSNEFHFFTPSDSVQDVTLFAKYTLRADDMFLNRMIGGTFEG
SNDPDFREKEVLYLINEKPKRLQTVVQSYSSKPYRYVRYVGPKESHCNIAEVAFYTPNDT
ASLKGKVIGTPGCFQKDGSHEYTNVFDGDVTTSFDYIEPSGGWSGIDLGIPKQIEKIVYT
PRSYDNYIRSGDKYELFYCTGKDKWESLGKKVSEADSLVYRDVPVNVLLLLKNYSKGVQE
RIFTYERKGQVWK

Enzyme Prediction     

No EC number prediction in MGYG000002281_01129.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM62	460	536	1.4e-25	0.5648854961832062
CBM62	543	606	9.7e-20	0.48854961832061067

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01841	Transglut_core	0.002	207	294	11	102	Transglutaminase-like superfamily. This family includes animal transglutaminases and other bacterial proteins of unknown function. Sequence conservation in this superfamily primarily involves three motifs that centre around conserved cysteine, histidine, and aspartate residues that form the catalytic triad in the structurally characterized transglutaminase, the human blood clotting factor XIIIa'. On the basis of the experimentally demonstrated activity of the Methanobacterium phage pseudomurein endoisopeptidase, it is proposed that many, if not all, microbial homologs of the transglutaminases are proteases and that the eukaryotic transglutaminases have evolved from an ancestral protease.
smart00460	TGc	0.008	243	294	1	60	Transglutaminase/protease-like homologues. Transglutaminases are enzymes that establish covalent links between proteins. A subset of transglutaminase homologues appear to catalyse the reverse reaction, the hydrolysis of peptide bonds. Proteins with this domain are both extracellular and intracellular, and it is likely that the eukaryotic intracellular proteins are involved in signalling events.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQA08332.1	0.0	1	673	1	672
ALJ44269.1	0.0	1	673	24	696
QQR19037.1	0.0	1	673	1	672
ANU59567.1	0.0	1	673	1	672
ANU59553.1	0.0	1	673	1	674

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2YB7_A	1.17e-06	450	535	53	137	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],2YB7_B Chain B, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],2YFU_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],2YFZ_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],2YG0_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000041	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	26