CAZyme Information: MGYG000002281_01254

Basic Information

• Species: Bacteroides faecis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides faecis
• CAZyme ID: MGYG000002281_01254
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
673	MGYG000002281_4|CGC1	76065.58	5.5742

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002281	6145961	Isolate	China	Asia

• Gene Location: Start: 105839; End: 107860 Strand: +

Full Sequence      

MKNQKLLLKKMSGVSLMLLLFLFISNCASGDKIFSTDVWNITYDDQQGGIALTYKSKNIC
NGMYASYQWEGKEIKTSDYARHKISTGKVSDSFGKGHIYKVEYTDKELPKLTQYFYLYPG
KEYILTDFTVEAKEEIRSGRMAPVNVDSISGFLQAGDNRALFVPFDNDKWIRYQSHPLGF
DTLVSYEVTAIFNNESRNGLVIGSVEHDNWKTGISIGKGDRDNIGSLVCYGGIADEQTRD
VKAHGALAGKKIKSPKVFLGFFEDWCDGLEAYAKANAVIAPPKAWEKAVPFGWNSWGALQ
FNLTYEKAMEVSDYFKENLQNNHFVNPDQTVYIGLDSGWDCMNEEQLKSFIEKCKSNGQI
GGIYWTPFTDWARDPERTVDAAPEYKYKDIYLYANGKPQELDGAYAVDPTHPAVEAMMKK
TSGLFHRAGFEYVKMDFMTHGAMEADKWYNPEITTGIQGYNYGMKLLNQYFGDMYINLSI
SPVFPAQYAQSRRIACDAWNQIKDTEYTLNALSYGWWQKYIYQYNDADHIVLRDATDGEN
RARITSGVITGIYITGDDFSAGGGKDAKEKSQKYLTNAAVNAVATGEVFRPVEGNGEKSE
HIFVRKTPDGRFHCAVFNYSDQEQTTVLSLERIGLDKARGYQVKELWSGNETFATGQLEV
TVPSKDVQLLEFK

Enzyme Prediction     

No EC number prediction in MGYG000002281_01254.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	4.66e-14	290	558	3	278	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam17801	Melibiase_C	1.47e-11	601	672	5	74	Alpha galactosidase C-terminal beta sandwich domain. This domain is found at the C-terminus of alpha galactosidase enzymes.
COG3345	GalA	9.92e-06	269	442	271	456	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd14792	GH27	3.80e-04	290	528	2	214	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT41076.1	0.0	1	673	1	673
QUT73244.1	0.0	1	673	1	673
ALJ44661.1	0.0	1	673	1	673
QQA08702.1	0.0	1	673	1	673
AAO78239.1	0.0	17	673	1	657

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000039	0.019050	0.980923	0.000008	0.000011	0.000008

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002281_01254.