CAZyme Information: MGYG000002281_01820

Basic Information

• Species: Bacteroides faecis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides faecis
• CAZyme ID: MGYG000002281_01820
• CAZy Family: GH3
• CAZyme Description: Xylan 1,4-beta-xylosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
176	MGYG000002281_7|CGC1	20360.36	8.1289

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002281	6145961	Isolate	China	Asia

• Gene Location: Start: 91287; End: 91817 Strand: +

Full Sequence      

MNIKRDLLTILACSMSLHLLAQEKFPFRDPQLPVEQRVEDLVSRLTLEEKVKQMLNSTPP
VERLGIPAYNWWNECLHGIGRTKYHVTVFPQAIGMAAAWNDALIKEVASSIADEGRAIYN
DTQRKEDYSQYHALTYWTPNINIFRDPPLGTRTGNLICRSCRWYERPSESIARIVR

Enzyme Prediction     

EC	3.2.1.37	3.2.1.-	3.2.1.21	3.2.1.55

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	61	152	1.7e-18	0.3611111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN03080	PLN03080	1.94e-35	25	150	40	167	Probable beta-xylosidase; Provisional
COG1472	BglX	4.42e-11	63	147	57	128	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK15098	PRK15098	9.70e-08	11	150	9	168	beta-glucosidase BglX.
pfam00933	Glyco_hydro_3	2.06e-07	63	118	63	117	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHW60588.1	1.04e-49	1	150	1	148
SDS34249.1	2.50e-49	25	150	32	157
QJD97902.1	2.85e-49	7	150	14	157
QIL77665.1	2.01e-48	23	150	41	168
QXD14810.1	2.52e-48	21	150	18	146

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VC6_A	1.20e-20	37	150	25	142	ChainA, xylan 1,4-beta-xylosidase [Phanerodontia chrysosporium]
7VC7_A	1.20e-20	37	150	25	142	ChainA, xylan 1,4-beta-xylosidase [Phanerodontia chrysosporium]
5A7M_A	1.69e-16	36	150	51	165	ChainA, BETA-XYLOSIDASE [Trichoderma reesei],5A7M_B Chain B, BETA-XYLOSIDASE [Trichoderma reesei]
5AE6_A	1.69e-16	36	150	51	165	ChainA, BETA-XYLOSIDASE [Trichoderma reesei],5AE6_B Chain B, BETA-XYLOSIDASE [Trichoderma reesei]
6Q7I_A	1.25e-14	26	150	41	164	GH3exo-beta-xylosidase (XlnD) [Aspergillus nidulans FGSC A4],6Q7I_B GH3 exo-beta-xylosidase (XlnD) [Aspergillus nidulans FGSC A4],6Q7J_A Chain A, Exo-1,4-beta-xylosidase xlnD [Aspergillus nidulans FGSC A4],6Q7J_B Chain B, Exo-1,4-beta-xylosidase xlnD [Aspergillus nidulans FGSC A4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A5JTQ2	2.81e-27	9	150	37	178	Beta-xylosidase/alpha-L-arabinofuranosidase 1 (Fragment) OS=Medicago sativa subsp. varia OX=36902 GN=Xyl1 PE=1 SV=1
Q9SGZ5	7.08e-27	25	150	36	163	Probable beta-D-xylosidase 7 OS=Arabidopsis thaliana OX=3702 GN=BXL7 PE=2 SV=2
D5EY15	9.84e-27	4	150	2	148	Xylan 1,4-beta-xylosidase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyl3A PE=1 SV=1
Q9LXA8	1.80e-26	25	150	40	166	Probable beta-D-xylosidase 6 OS=Arabidopsis thaliana OX=3702 GN=BXL6 PE=2 SV=1
Q9FGY1	2.44e-26	32	150	54	173	Beta-D-xylosidase 1 OS=Arabidopsis thaliana OX=3702 GN=BXL1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001337	0.997537	0.000586	0.000188	0.000167	0.000162

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002281_01820.