CAZyme Information: MGYG000002281_02556

Basic Information

• Species: Bacteroides faecis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides faecis
• CAZyme ID: MGYG000002281_02556
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
734	MGYG000002281_12|CGC2	84055.13	5.1051

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002281	6145961	Isolate	China	Asia

• Gene Location: Start: 69198; End: 71402 Strand: +

Full Sequence      

MNMRLLLLLLFGSVVMYTSCRSTSAPIDSLAARVTENTSKDQILFRLVIDEADPAKDYFE
IDSKDDKVLITGNSDLSLATGLNWYLKYVAGIHLSWNNPSQKLPEVLPLPQKKIRQTTAM
KNRYYLNYCTYSYSMAFWDWERWEKEIDWMAMHGINMPLSITGMEVVWYNLLKRIGYTTE
EINEFISGPAFMAWWQMNNLEGWGGPNPDSWYRQQEALQKKIIARMRELGIEPVFPGYAG
MVPRNIGEKLGYQIADPGKWCGFPRPAFLSTEDEHFDSFAAMYYEELEKLYGKAKYYSMD
PFHEGGNTEGVDLAKAGTSIMGAMKKANPEAVWVMQAWQANPREAMVNTLDSGDLLVLDL
YSEKLPQWGDPESMWYREKGFGKHDWLYCMLLNFGGNVGLHGRMEQLVNGYYNACAHING
KTLRGVGATPEGIENNPMMFELLYELPWREERFSPDIWLQGYLKARYGDDLSPEVTEAWR
ALEHTVYNAPKNYQGEGTVESLLCARPGFHLDRTSTWGYAKLFYSPDSTAKAAQLLLSVA
DRYKGNNNFEYDLVDIVRQSLADKANVLLEEISQSYDRKDKDSFRKQTQQFLGLILSQDS
LLSTRKEFSVSSWLSAARSLGTTEEEKKLYEWNASALITVWGDSIAANQGGLHDYSHREW
SGLLKDLYYQRWNTFFEQKQQELDGKLDKSTAEPIHFYGMEKAWAEKSKTVDVSGKNGPS
VIETAKTVYRSAVE

Enzyme Prediction     

No EC number prediction in MGYG000002281_02556.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	65	729	1.1e-250	0.9939668174962293

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05089	NAGLU	0.0	123	450	1	333	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
pfam12972	NAGLU_C	3.15e-88	458	713	1	247	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
pfam12971	NAGLU_N	4.79e-25	25	108	1	81	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW86693.1	0.0	1	734	9	742
AAO79464.1	0.0	1	734	9	742
QUT42246.1	0.0	1	734	1	734
QUT70043.1	0.0	1	734	1	734
QQA07527.1	0.0	1	734	1	734

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VC9_A	1.06e-164	23	712	170	854	Family89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	1.32e-164	23	712	178	862	ChainA, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	1.56e-163	23	712	193	877	CpGH89(E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]
4XWH_A	3.92e-115	67	677	51	657	Crystalstructure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9FNA3	1.19e-120	67	711	94	784	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1
P54802	3.88e-114	67	677	74	680	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000382	0.143996	0.855429	0.000073	0.000074	0.000063

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002281_02556.