CAZyme Information: MGYG000002281_03557

Basic Information

• Species: Bacteroides faecis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides faecis
• CAZyme ID: MGYG000002281_03557
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
550	MGYG000002281_21|CGC1	63512.85	5.8596

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002281	6145961	Isolate	China	Asia

• Gene Location: Start: 28425; End: 30077 Strand: +

Full Sequence      

MYKMKNDGWIHDIAKALCCIFLIMTSGGMLYSCSSENEDPVPPVQEGTENDEKEKYTYVY
QLKADNYNMPTEGTISPEYDDSPEGKDISSLVDGDWTTSFYTPNNSVSIIWKGKEPVVAR
YYSVMATGDKEGNAPGAWSLYGSNDNVKWAELDNRIRQEFEKREKKFLELRHKEAYQYYK
LTIHRNQGGKGIEIQEWMLQTKRTIDTPLLTDFPEGSTPKEIGKRLGKLFAKGKHNGKTL
SYPETFTWNGALKYAEVAKDNELIRSLKDGFESFFTTDRHFLPGIDHVDRNMFGSLPLTL
YLITKDERYREMGIPYADTQWEVPENASASAKSWAAKGYSWQTRLWIDDMYMIPVIQTHA
YKVTGELKYVERAAKEMAMYLDELQRTNGLFYHAPDVPYFWGRGNGWVAAGMAEVLRYLP
ESSPYHLPIVRGFQTMMASLKNYQTEEGMWRQLIDKPDCWVETSGSAMFTYAFIMGVKYG
WLPVKEYGEAARRAWLAMLTYINSNDKVREVCVGTNKKNDMQYYYDRPRNTGDYHGHAPY
LWCTVALLEE

Enzyme Prediction     

No EC number prediction in MGYG000002281_03557.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	236	547	1.2e-71	0.9668674698795181

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.50e-49	242	543	29	335	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	7.01e-43	242	541	36	347	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT40874.1	0.0	1	550	1	550
BCA52196.1	0.0	1	550	5	554
ALJ39810.1	0.0	4	550	1	547
QUT73025.1	0.0	1	550	1	550
ANU59912.2	7.97e-220	212	549	2	339

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	6.98e-29	345	548	199	411	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
1NC5_A	6.09e-25	250	547	49	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.40e-24	250	547	39	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
5NOA_A	2.39e-20	346	500	158	326	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	2.00e-19	346	495	141	304	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	3.33e-24	250	547	49	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
O31521	3.76e-14	242	528	31	316	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
T2KPL9	6.61e-14	316	498	137	329	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	8.31e-14	346	524	201	396	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
L7P9J4	6.68e-13	316	508	139	340	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000810	0.013224	0.985876	0.000016	0.000064	0.000017

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002281_03557.