CAZyme Information: MGYG000002281_03562

Basic Information

• Species: Bacteroides faecis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides faecis
• CAZyme ID: MGYG000002281_03562
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	MGYG000002281_21|CGC1	42839.71	9.1279

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002281	6145961	Isolate	China	Asia

• Gene Location: Start: 36794; End: 37897 Strand: +

Full Sequence      

MCKKLLLLLLLLPFQLLCAQTKLLTDFPEGYTPEEVGKRLAYRFIGEKHALHAGKWIGYP
ETFYWNGALKYAAVTKDKELIKLLQNKFEPLFTSEKALQPIMNHVDLNMFGSLPLEMYHV
TKDKKYWYLGLPYADSQWEVPANAKPKEKEWAEKGYSWQTRLWIDDMYMITIVQTHAYKV
TKDRKYIDRAAKEMVMYLDELQRPNGLFYHAPDVPYYWGRGNGWMAAGMSELLRCLPKKH
KDRARILEGYQKMMKSLKEYQNAEGLWNQLIDKPDCWTESSGSAMFTFAFIMGVKNGWLD
ADEYAPAARKAWLALVPYVNEKNQVKAVCVGTNKKNDLQYYYDRPRRTGDYHGQGPVLWC
TVALLEK

Enzyme Prediction     

No EC number prediction in MGYG000002281_03562.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	57	364	1.9e-73	0.9548192771084337

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	2.33e-47	58	360	28	335	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.55e-41	31	358	14	347	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ39814.1	2.67e-275	1	367	1	367
BCA52191.1	2.56e-273	1	367	1	367
QUT73021.1	2.56e-273	1	367	1	367
QUT40870.1	2.56e-273	1	367	1	367
QDH53377.1	5.49e-243	1	367	1	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	2.05e-34	162	359	199	405	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
1NC5_A	2.08e-29	53	364	36	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	8.92e-29	53	364	26	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4Q88_A	6.70e-22	163	312	141	304	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
5NOA_A	1.59e-21	163	312	158	321	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.14e-28	53	364	36	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
T2KPL9	9.75e-18	47	325	46	339	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	2.52e-16	163	341	201	396	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
L7P9J4	2.22e-15	27	325	31	340	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
O31521	2.60e-14	65	366	31	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000219	0.999183	0.000163	0.000138	0.000132	0.000131

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002281_03562.