CAZyme Information: MGYG000002281_04197

Basic Information

• Species: Bacteroides faecis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides faecis
• CAZyme ID: MGYG000002281_04197
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1103	MGYG000002281_30|CGC1	126074.94	6.3943

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002281	6145961	Isolate	China	Asia

• Gene Location: Start: 47956; End: 51267 Strand: -

Full Sequence      

MAEKTSDKPYWQDVQVVSVNKEYPRTSFMTYDNRTDALTGKFEKSNYYQLLNGTWKFFFA
DSYKDLPANITDPSVNTDSWNDIKVPGNWEVQGYGVAIYTNHGYEFKARHPQPPILPEAN
PVGVYRRDIDIPADWQERDIYLHLAGAKSGVYVYVNGQEVGYSEDSKNPAEFLISPYVKP
GKNVLTLKIFRWSTGSYLECQDFWRISGIERDVYLYSQPKAALKDFRVKSTLDDSYKNGV
FALNVDLRNHRPAATNLTLVYELLDAQGKVVASEEKTTYVPTNETRTLSFDKNLADVRTW
TSEQPNLYKLMMTVKEDGKVNEIIPFNVGFRRIEIKPIDRKAANGKPYVCLFINGQPLKM
KGVNIHEHNPETGHYVTEELMRRDLELMKQHNLNSVRLCHYPQDRRFYELCDEYGLYVYD
EANIESHGMYYDLRKGGSLGNNPEWLKPHMDRTINMFERNKNYPSVTFWSLGNEAGNGYN
FYQTYLWLKEADKNIMERPVNYERAQWEWNTDMYVPQYPGADWLEDIDKNGSDRPVVPSE
YAHAMGNSTGNLWGQWQAIYKYPNLQGGYIWDWVDQGLLQKDKNGREYWAYGGDFGVNAP
SDGNFNCNGLVNPDRSPHPAMAEVKYVHQNIGFEAIDAASGKFNITNRFYFTNLKKYQIH
YSVVANGKTVRSGKVSLDIAPQASKEFTVPVNGLKARPGTEYFVNFNVIAVEPEPLIPAG
YEIAYDQFRLPVEAEKNTYKANGPALQPHTQGDELTVFSSKVNFVFNKKSGLVTSYKVDG
TEYFKDGFGIQPNFWRAPNDNDYGNGAPKRLHVWKQSSKDFHVTDTKVSTEDKAVLLQAT
YLLAAGNLYVVTYKIYPSGVVNVNARFTSTDMQATETEVSEATRMATFTPGSDAARKAAS
KLEVPRIGVRFRLPARMNNVQYFGRGPEENYIDRNHGTIVGVYQTTADKMYFNYVRPQEN
GHHTDTRWLTLSPNKGSGLAIVADSLVGFNALRNSIEDFDSEEALPHPYQWNNFSPEEVA
NHDENAARNVLRRMHHVNDIIPRDFVEVCVDMKQQGVGGYDSWGARPEPFHQIPANREYN
WGFTLVPVRSGSQAAEAAQYDYR

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	37	939	4.3e-211	0.973404255319149

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09525	lacZ	0.0	11	1085	17	1024	beta-galactosidase.
PRK10340	ebgA	0.0	11	1102	4	1015	cryptic beta-D-galactosidase subunit alpha; Reviewed
COG3250	LacZ	1.37e-151	51	934	15	800	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
smart01038	Bgal_small_N	9.02e-102	759	1085	2	272	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.
pfam02836	Glyco_hydro_2_C	1.43e-88	351	633	8	302	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT69940.1	0.0	1	1103	22	1124
BCA48787.1	0.0	1	1103	1	1103
QUT42142.1	0.0	1	1103	22	1124
AAO79346.1	0.0	1	1103	1	1103
ALJ43393.1	0.0	1	1103	22	1124

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S6Z_A	1.18e-240	9	1085	1	979	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	1.22e-240	9	1085	2	980	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
3DEC_A	5.64e-217	8	1091	4	1000	ChainA, Beta-galactosidase [Bacteroides thetaiotaomicron VPI-5482]
3BGA_A	1.84e-214	9	1091	8	1004	Crystalstructure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],3BGA_B Crystal structure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
3MUY_1	1.49e-148	11	978	16	953	Chain1, Beta-D-galactosidase [Escherichia coli K-12],3MUY_2 Chain 2, Beta-D-galactosidase [Escherichia coli K-12],3MUY_3 Chain 3, Beta-D-galactosidase [Escherichia coli K-12],3MUY_4 Chain 4, Beta-D-galactosidase [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	6.67e-240	9	1085	2	980	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
O52847	2.06e-220	9	1088	18	1034	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
A5F5U6	1.37e-183	11	1093	13	1024	Beta-galactosidase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=lacZ PE=3 SV=2
Q9K9C6	1.04e-169	4	1088	2	1014	Beta-galactosidase OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=lacZ PE=3 SV=1
Q6LL68	8.63e-169	11	1087	12	1027	Beta-galactosidase OS=Photobacterium profundum (strain SS9) OX=298386 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002281_04197.