CAZyme Information: MGYG000002281_04273

Basic Information

• Species: Bacteroides faecis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides faecis
• CAZyme ID: MGYG000002281_04273
• CAZy Family: GH93
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
602		65972.23	4.9523

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002281	6145961	Isolate	China	Asia

• Gene Location: Start: 15106; End: 16914 Strand: -

Full Sequence      

MKGLLKTAVLLATFCATAMACGGGGEDALDQKGGDGGGTGNKGDKEESEQPFVAHITPID
KLNQGVSVINSHADVTSHSSLKMNFRTYSQLGESVLKSAKPNYVRVKKLANDGYIMFYHN
NQIGASCSYATSTDFKTWSYKGKLFANYSIIDSKGEKNDRRYSNCDGLVLSNGDILAVAS
YRANNGYRDLPKDAGIEMRRSTDNGVTWSEPVSVYQGVNWEPYLLELSSGEIHCYFTDSS
RTGIEGKDTGTAMVISRDGGQTWTPSFGSIPYYVIRMKWEQDGKTYFNHQMPSVIQLKGS
NELAAAVETNNRGTYYISLAYSGEDGEWDHLDADQEGPADSDNLSFLGSAPYLSQFPSGE
TVLSYNKSSTFYMKMGDAKARNFGSAYSPFSGKGYWGTLNLENSHQLVGAMPDTSNGTIM
LSQFILNHRIDAICRSVKVDGNNQEWANTDHALFVGEKSQVQGTLRCSCDDKNVYFLVEV
LDRSLLRGDYATVYLSPDDSKSLANGAKRIQVSMDGLKSTETYAGKWNSAEMGVEVKTYV
CNDTNEDRIDNYGYIAEISIPRSSLTISSGQVLVNFSITDNKEEEAVSDVSSISRWIPVA
GL

Enzyme Prediction     

No EC number prediction in MGYG000002281_04273.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH93	102	372	7.5e-21	0.8631921824104235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	1.07e-12	168	328	20	186	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
cd00241	DOMON_like	1.54e-06	456	581	13	145	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
cd09619	CBM9_like_4	1.82e-06	470	595	45	174	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
cd15482	Sialidase_non-viral	3.04e-05	114	320	163	336	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	3.34e-04	124	265	79	200	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBD46557.1	1.73e-08	139	265	136	268
AMV36480.1	4.72e-08	150	270	934	1073
ATS04713.1	5.06e-08	143	364	128	350
ATS11379.1	5.06e-08	143	364	128	350
ATS08837.1	8.84e-08	143	364	128	350

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000160	0.109549	0.890160	0.000043	0.000052	0.000044

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002281_04273.