CAZyme Information: MGYG000002281_04656

Basic Information

• Species: Bacteroides faecis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides faecis
• CAZyme ID: MGYG000002281_04656
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
408	MGYG000002281_44|CGC1	46232.64	8.3706

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002281	6145961	Isolate	China	Asia

• Gene Location: Start: 8074; End: 9300 Strand: +

Full Sequence      

MKNLLIMAFFLGLTLQLSAGTGGNNAVIVEKTTASPMEKTSVNWQKMADGMSKALIKHFW
GANFKGYENRYYFNYGSDLSNMTTNHYWPQAHAMDVMVDAYMRTGSKQYLNIYPLWWEGA
PKFNFSGRAEDPWWNVFVDDMEWIALAQIRMFESTKDTKYLKKAKQMYDDWIWSTWGPED
EAPWFGGITWKTDVAKSKNACSNGPAALIAARLYNFYDAIGKTRGKSKQAYLNEAIKIYT
WEKNNLFDRQTGAVYDSMNGEGKITKWTFSYNAGTFLGAAHELYKITGDKQYLADAVKVA
NFVIDHLSTNEGVLPDAVGGDGGLFHGIFFRYFVKLINEPALDGTNYNKFRNYITHCATV
MAEQGVNGKTMLYSGRWRKAPADDEGVGLTSHLTGCMLMEAMCVLKQR

Enzyme Prediction     

No EC number prediction in MGYG000002281_04656.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	47	390	2.8e-84	0.946927374301676

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03663	Glyco_hydro_76	7.51e-43	44	388	2	342	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
COG4833	COG4833	6.42e-38	44	401	3	366	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
cd04434	LanC_like	0.003	144	343	7	181	Cyclases involved in the biosynthesis of lantibiotics, and similar proteins. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthionine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as a precursor peptide and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans), in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. A related domain is also present in LanM and other pro- and eukaryotic proteins with poorly characterized functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAO76990.1	2.04e-293	1	408	1	408
QMW88830.1	2.04e-293	1	408	1	408
QUT39865.1	6.82e-292	1	408	1	408
QQA09722.1	3.94e-291	1	408	1	408
QUT72195.1	3.94e-291	1	408	1	408

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SHD_A	1.01e-57	87	406	88	390	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	3.06e-56	87	406	89	391	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	2.33e-55	87	406	89	391	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
3K7X_A	9.19e-38	44	406	3	341	ChainA, Lin0763 protein [Listeria innocua]
4BOK_A	4.45e-28	49	345	8	282	ChainA, Alpha-1,6-mannanase [Niallia circulans]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002235	0.423623	0.573675	0.000175	0.000144	0.000141

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002281_04656.