CAZyme Information: MGYG000002281_04669

Basic Information

• Species: Bacteroides faecis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides faecis
• CAZyme ID: MGYG000002281_04669
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
759	MGYG000002281_44|CGC2	83625.36	4.8506

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002281	6145961	Isolate	China	Asia

• Gene Location: Start: 25495; End: 27774 Strand: +

Full Sequence      

MKIRNLVLGALCGITFFSCSASGGGKDAEMDRFITDLMGKMTIREKLGQLNLPSGGDLVT
GSVMNTELGDMIRKEEIGGFFNVKGVKKIYDLQRLAVEETRLKIPLIVGADVIHGYETIF
PIPLALSCSWDTLAVQQMARISAIEASADGICWTFSPMVDICRDARWGRIAEGSGEDPYL
GSLLAKAYVRGYQGNNMQGRDEILSCVKHFALYGASEAGKDYNTVDMSHLRMYNEYFAPY
RAAVEAGVGSVMSSFNIVDGIPATANKWLLTDVLRDEWGFQGLLVTDYNSIAEMAVHGVA
PLEEASVRALQAGTDMDMVSCGFLNTLEESLKEGKVTEAQINTACRRVLEAKYKLGLFAD
PYKYCDTLRVEKELYTADHRAAAREIAAKTFVLLKNEKNLLPLEEKGKIALIGPMADARN
NMCGMWSMTCTPSGHGTLLEGIRSAAGDKAEILYAKGSNVYYDEEMEKGAVGIRPLERGN
DRQLLAEALRTAARADVIVAAVGECAEMSGESPSRTNLEIPDAQQDLLKALVKTGKPVVL
LLFTGRPLVLNWENEHVPAILNVWFGGSETGDAVADVLFGKVVPSGKLTTTFPRSVGQLP
LFYNHLNTGRPDPDNRVFNRYASNYLDESNEPLYPFGYGLSYTDFVYGDLQLSSETLPKN
GTLTASVTVTNRGDCDGYETVQIYLRDIYAEVARPVKELKGFERIFLKKGESREVKFVIT
EDDLKFYNSGLQYIYEPGEFDVMIGTNSRDVQTKRFSAE

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	98	319	6.7e-69	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	31	756	35	762	beta-glucosidase BglX.
pfam00933	Glyco_hydro_3	4.63e-108	42	351	1	316	Glycosyl hydrolase family 3 N terminal domain.
COG1472	BglX	8.38e-107	41	460	1	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	6.31e-76	118	719	112	742	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	7.29e-76	392	642	2	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQA09810.1	0.0	1	759	1	759
ALJ40714.1	0.0	1	759	1	759
QMW88819.1	0.0	1	759	1	759
AAO76979.1	0.0	1	759	1	759
QUT72184.1	0.0	1	759	1	759

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXN_A	0.0	29	757	9	750	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5XXL_A	0.0	29	757	9	750	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	7.03e-314	29	757	8	749	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
6R5I_A	1.98e-238	29	757	2	731	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5P_A	5.81e-238	22	757	27	763	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5P_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	5.35e-225	31	756	35	762	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	1.26e-220	31	756	35	762	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH0	1.32e-138	87	757	48	719	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	1.64e-105	13	756	13	752	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	4.06e-100	27	754	32	774	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000021	0.003631	0.996393	0.000001	0.000002	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002281_04669.