CAZyme Information: MGYG000002281_04937

Basic Information

• Species: Bacteroides faecis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides faecis
• CAZyme ID: MGYG000002281_04937
• CAZy Family: GH141
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
789	MGYG000002281_59|CGC1	89929.86	6.2648

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002281	6145961	Isolate	China	Asia

• Gene Location: Start: 7623; End: 9992 Strand: +

Full Sequence      

MFYILNQLFRLMKTKLLAFLPFMATFAMGQQTYFVSHGGNDSADGSLNSPLLHIHEALER
GKASAEREIHIYIREGKYYLDTPLVVDAGEWKNKRLTLSAYNNEPVVLSGARKLSLKWVK
QKNGIWKSKTEADKGDQLFVGGEKRILARYPNFEEGTIFNGTAADALAPARVKRWKSPGG
GFIHALHARDWGDMHYVITGKDDKSVLFEGGYQNNRPSNMHDKYRFVENIYEELDAPGEW
FLDGKAGYLYYYPYPDENIDNEIFEIAEIPSLIEIKGIENDRASDVTVRGICFSQTSRTF
MADYEPLLRSDWAIYRGAAVFIENAERCRIEDCEFTGLGGNAIFLSRHIDGCVVKGNYIH
QIGASAICIVGDTSAVRSGVFKYEQSVPYELMDKIPGPKNELYPRRCIVEDNLIHDIGLV
EKQVAGIQIQVAREINVRHNTIYRVPRAAINIGDGSFGGHVIEYNDAFATVLETSDHGAF
NSWGRDRFWHPSYEKMSLMVAEHPELVLLDALFTTYIRYNRFRCDHGWDIDLDDGSSNYH
IYGNVCLRGGIKLREGFNRIVENNILINNTLHPHLWFQNCGDIIRRNVFTQAYLPIELKS
WGKMVDYNFFSSKNALKQVQKDDTDAHSTSGILHFVDYQHYNLTLPDTSQAFEIGFENIP
QNGFGVYSPRLKRKAEKPELSELLVSDSSNTNQTYLWEKAEVRLVSGLGDRSAYGLPDEK
GCIVLKMDNAVNMQDAGLKENDVIYSIYGEDIDSVETLMRLTNKYKWKKTLLLECFRNQQ
KLKISLVLD

Enzyme Prediction     

No EC number prediction in MGYG000002281_04937.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH141	32	486	1.5e-58	0.9184060721062619

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13229	Beta_helix	2.23e-09	317	463	23	155	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	2.75e-07	318	461	1	129	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
cd00987	PDZ_serine_protease	2.51e-06	710	786	14	90	PDZ domain of trypsin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, though binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.
pfam13229	Beta_helix	8.59e-05	278	376	59	151	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
cd00991	PDZ_archaeal_metalloprotease	3.18e-04	735	782	25	72	PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms. May be responsible for substrate recognition and/or binding, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of protease-associated PDZ domains a C-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in Eumetazoan signaling proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWW32784.1	3.93e-199	33	761	33	772
BAU63437.1	9.32e-40	54	567	93	593
AFZ35556.1	9.25e-37	54	666	84	710
AWV97657.1	1.90e-29	33	665	29	707
QZT37819.1	1.15e-28	16	666	8	719

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQP_A	9.39e-17	34	455	28	501	Glycosidehydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_B Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_C Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_D Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_E Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_F Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_G Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_H Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.155225	0.833488	0.010177	0.000391	0.000322	0.000373

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002281_04937.