CAZyme Information: MGYG000002282_00142

Basic Information

• Species: Parabacteroides gordonii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides gordonii
• CAZyme ID: MGYG000002282_00142
• CAZy Family: GH43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
578	MGYG000002282_1|CGC4	65742.55	5.0963

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002282	6348794	Isolate	China	Asia

• Gene Location: Start: 178789; End: 180525 Strand: +

Full Sequence      

MKSLLLTFMIAPLLISCQGSYPIKAKISQSPKTFCNPVNLNYRFMKIDGGEGIREAADPV
VVPFKDKFYLFASKSSGYWYSDDFTDWKHVFITDSVLPIEDYAPGLFVHNDYLYYVGSTH
GKGMLYRSSQPEKGEWEPVKEILSYWDPAFYVEGDNLYMYHGCSPVDPIRMQVLDLNTLD
ARSGIIDCFNSDKENRGWERTGELNELSRRPYIEGAWMTAHQGKYYLQYAAPGTEWKSYA
DGVYVSTSPSGPFTYMENSPVSYKPTGFIGGAGHGCLFTVGNENYWKAATNSISVRHMFE
RRISFFPAGFDKDGYMFTNTYLGDYPMYLPGGKEQTSGMDQPGWMLLSYKKTVTASSSLD
GYPAENSVDEDSRTAWVAKSNNDTEWLQVDLQQLSSVHAIQVNFDEYGADQKGYVPRVYQ
SYIIYASANGEDWSTVVDYSTKKTDAPHDYIEFEEPFKARYIKLQNKAYTISSNLSVRDL
RIFGKGQGSKPRPVNEFDVRRDETDGCKAVLTWNEVPHAQGYIVRYGVAKDKLYSNFQVM
GDTRLEIGSLNNGVTYYFTIDTYNENGITRTEQVEVCR

Enzyme Prediction     

No EC number prediction in MGYG000002282_00142.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH43	56	314	7.7e-97	0.9961832061068703
CBM32	351	468	1.4e-23	0.8387096774193549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08982	GH43-like	2.16e-162	54	357	3	308	Glycosyl hydrolase family 43 protein; uncharacterized. This glycosyl hydrolase family 43 (GH43)-like subfamily includes uncharacterized enzymes similar to those with beta-1,4-xylosidase (xylan 1,4-beta-xylosidase; EC 3.2.1.37), beta-1,3-xylosidase (EC 3.2.1.-), alpha-L-arabinofuranosidase (EC 3.2.1.55), arabinanase (EC 3.2.1.99), xylanase (EC 3.2.1.8), endo-alpha-L-arabinanase and galactan 1,3-beta-galactosidase (EC 3.2.1.145) activities. These are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many of the enzymes in this family display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
pfam00754	F5_F8_type_C	4.91e-22	352	478	1	124	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd08978	GH_F	7.00e-22	57	286	1	245	Glycosyl hydrolase families 43 and 62 form CAZY clan GH-F. This glycosyl hydrolase clan F (according to carbohydrate-active enzymes database (CAZY)) includes family 43 (GH43) and 62 (GH62). GH43 includes enzymes with beta-xylosidase (EC 3.2.1.37), beta-1,3-xylosidase (EC 3.2.1.-), alpha-L-arabinofuranosidase (EC 3.2.1.55), arabinanase (EC 3.2.1.99), xylanase (EC 3.2.1.8), endo-alpha-L-arabinanases (beta-xylanases) and galactan 1,3-beta-galactosidase (EC 3.2.1.145) activities. GH62 includes enzymes characterized as arabinofuranosidases (alpha-L-arabinofuranosidases; EC 3.2.1.55) that specifically cleave either alpha-1,2 or alpha-1,3-L-arabinofuranose side chains from xylans. GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many of the enzymes in this family display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. GH62 are also predicted to be inverting enzymes. A common structural feature of both, GH43 and GH62 enzymes, is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
cd08991	GH43_HoAraf43-like	1.69e-17	57	305	1	272	Glycosyl hydrolase family 43 protein such as Halothermothrix orenii H 168 alpha-L-arabinofuranosidase (HoAraf43;Hore_20580). This glycosyl hydrolase family 43 (GH43) subgroup includes Halothermothrix orenii H 168 alpha-L-arabinofuranosidase (EC 3.2.1.55) (HoAraf43;Hore_20580). It belongs to the glycosyl hydrolase clan F (according to carbohydrate-active enzymes database (CAZY)) which includes family 43 (GH43) and 62 (GH62) families. This GH43_ HoAraf43-like subgroup includes enzymes that have been annotated as having xylan-digesting beta-xylosidase (EC 3.2.1.37) and xylanase (endo-alpha-L-arabinanase, EC 3.2.1.8) activities. GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many GH43 enzymes display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
cd00057	FA58C	3.80e-17	353	484	14	143	Substituted updates: Jan 31, 2002

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT49472.1	6.68e-201	247	578	14	345
ALM50367.1	1.50e-169	33	574	29	570
AOE53986.1	1.50e-169	33	574	29	570
BBE16007.1	2.41e-168	29	570	26	566
QIA09145.1	9.48e-167	28	574	29	575

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QQS_A	2.14e-07	33	274	4	256	Crystalstructure of a thermostable family-43 glycoside hydrolase [Halothermothrix orenii H 168],4QQS_B Crystal structure of a thermostable family-43 glycoside hydrolase [Halothermothrix orenii H 168]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000108	0.095144	0.904655	0.000036	0.000045	0.000035

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002282_00142.