CAZyme Information: MGYG000002282_02276

Basic Information

• Species: Parabacteroides gordonii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides gordonii
• CAZyme ID: MGYG000002282_02276
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
780	MGYG000002282_5|CGC5	84903.97	5.0063

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002282	6348794	Isolate	China	Asia

• Gene Location: Start: 257784; End: 260126 Strand: +

Full Sequence      

MSKTTSLIIGLIAFAGQAMAQQPLYKQATAPVEDRVNDLIGRMTVEEKVGQLCCPLGWEM
YTKTKNGVVASDLYKERMKAMPIGSFWAVLRADPWTQKTLETGLNPELSAKALNALQKYA
VEETRLGIPVLFAEECPHGHMAIGTTVFPTSLSQASTWNAELMYRMGEAIALEARSQGAN
IGYGPVLDIAREPRWSRMEETFGEDPVLTSNLGVAFMKGMQGDTQNDGKHLFSTLKHFAA
YGIPEAGHNGARANVGMRQLFSDYLPPFKKAVEEGVGTIMTSYNTIDGVPCTSNKYLLTD
VLRDQWGFKGFVYSDLTSIEGIVGARVAKDNKDAAVQALKAGLDMDLGGNAYGKNLKKAY
EEGLITMEDLDRAVANVLRLKFRMGLFENPYVSPEQAEQLVRSKAHKELAREVAREGIVL
LKNDGVLPLKKTIGSIAVIGPNADMMYNQLGDYTAPQEREEIVTVLDGIRKAVSPSTKVN
YVKGCAIRDVTASNILAAVDAARAADAVVLVVGGSSARDFKTKYIGTGAADVSTDGNQIL
SDMDCGEGYDRSTLRLLGDQEKLLEAVAATGKPLVVVYIQGRTLNMNLASEKAQALLTAW
YPGEQGGAAIADVLFGDYNPAGRLPVSVPRSEGQLPLFYSQGKQRAYVEEEGTPLYAFGY
GLSYTQFDYCGLEMQKGNGKDILQTVSCTVTNTGDRDGEEVVQLYICDKVASVSQAPILL
KAFERVSLKKDESKKITFTLGEEELSLYNMEMKQVVEPGDFKVMVGAASDDIRLKGEFTL

Enzyme Prediction     

No EC number prediction in MGYG000002282_02276.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	122	347	1.3e-73	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	1	780	1	764	beta-glucosidase BglX.
COG1472	BglX	4.86e-104	43	475	1	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	5.25e-101	125	766	78	769	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	2.89e-83	44	380	1	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	8.62e-59	418	664	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV43485.1	0.0	11	780	12	781
QEW35133.1	0.0	7	780	13	785
QQY39447.1	0.0	7	780	15	787
ABR38266.1	0.0	7	780	13	785
SCD22149.1	0.0	3	780	4	781

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	1.09e-145	21	778	3	754	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	8.46e-145	21	778	3	754	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
6R5I_A	1.60e-142	36	769	7	722	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	8.87e-142	36	769	7	722	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5R_A	9.13e-142	36	769	8	723	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	2.65e-150	13	780	18	764	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	4.51e-148	13	780	18	764	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH0	4.00e-140	92	773	29	716	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	2.44e-124	10	773	13	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	1.14e-84	3	772	2	768	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000272	0.999094	0.000163	0.000160	0.000151	0.000139

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002282_02276.