CAZyme Information: MGYG000002282_02401

Basic Information

• Species: Parabacteroides gordonii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides gordonii
• CAZyme ID: MGYG000002282_02401
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
733	MGYG000002282_6|CGC1	82915.99	6.1781

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002282	6348794	Isolate	China	Asia

• Gene Location: Start: 43370; End: 45571 Strand: +

Full Sequence      

MKKYLLLLACIGTFASAEVKTDWKAQWINTERCQSASNTWLAYRKTVSIDEVPATLTAHI
AADSKYWLWINGQLAVFEGGLKRGPSPYDTYYDSVEIAPYLVSGENTIAVLVWHFGKNGF
SHVNSGLAALLFEAIAPGIEIVSDKSWRCGVYDAYQNAEAPYPNYRLSESNIRFDARLAE
EGWNLPGFKNTFPGAEIASVVGKAPLGQLVKRPIPMFKDFGLRDYPDIRQSAKGDTLFCR
LPYNCQFTPYLKVEAPEGNTIYMQTDNYRGGGPENVRAEYITRDGTQEYESYGWMSGHEM
WYIVPEGVNILEVKYRETGYDTEFAGSFHCNDPFLNELWKRSARTLYITMRDNYMDCPER
ERAQWWGDEVNELGEAFYALSTSSHQLAVKGIHELMNWQRADGSLFAPVPAGNWSKELPL
QILASVGWYGFYTQYYYSGDSTFVPAIYDRLHRYLHETWQVDKSGFPIERSGEWSWGDWG
EQIDMGVLTNCWYYLALKAEKEFALQLGKKADAEEISRMMYSIEKCFNTKYWTGTAYRSP
GYRGENDDRAQAMAVLSGLAPKDKYPAILKLLKKEYHASPYMEKYVLEALFHMDAPDAAL
QRMKDRYAGMLSYKEYTTLFEGWGVGAEGFGGGTINHAWSGGPLTLLSQKVCGIEPTSPG
FKTFRVKPQMGSLMEASATVETHYGKIKVDLKKSGRKILMEIQVPEQTGAVVISPKGKVQ
EVGSGTHKITCPF

Enzyme Prediction     

No EC number prediction in MGYG000002282_02401.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	262	712	2e-87	0.9047619047619048
CBM67	25	191	3.1e-32	0.9034090909090909

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	7.14e-23	323	651	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	3.26e-13	653	727	1	76	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	8.88e-08	53	215	3	166	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam02837	Glyco_hydro_2_N	0.001	12	112	44	133	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT48047.1	0.0	1	728	1	728
QJE27360.1	0.0	4	729	11	737
ABR43077.1	0.0	4	729	11	737
QRO16732.1	0.0	4	729	11	737
QCY56550.1	0.0	4	727	11	735

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000960	0.995073	0.003275	0.000272	0.000205	0.000189

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002282_02401.