CAZyme Information: MGYG000002282_02732

Basic Information

• Species: Parabacteroides gordonii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides gordonii
• CAZyme ID: MGYG000002282_02732
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377		43100.92	9.1238

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002282	6348794	Isolate	China	Asia

• Gene Location: Start: 83602; End: 84735 Strand: -

Full Sequence      

MKYFLIAGEASGDLHASNLMAALKEKDPEADFRFFGGDLMQAVGGTLVKHYREMAFMGFI
PVLLNLRTILNNMKTCEEDIRRYQPDVVILIDYPGFNLKIAKFVKTVLHLPVYYYISPKI
WAWKQYRIKDFRRYVDRMFCILPFETEFFHKLNYSVDYVGNPSVDSVAQYKEKQAALPDT
FMADEGLPDKPILALLAGSRRQEIKDNLPTMLEVAAAYPDYQPVIAGAPGLEPAYYKQYI
GNHPARIVFGKTYDLLQHSRAALVTSGTATLETSLFRVPQVVCYYVVAGRLASFIFRNFF
HTKYISLVNLIAGREVVQELFGARFSTRQIHDELGRILNDPAYRNQMLSGYDEVIRLLGK
PGASRRTAELIFQSLRH

Enzyme Prediction     

No EC number prediction in MGYG000002282_02732.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	357	9.9e-113	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.55e-107	1	376	2	376	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.09e-95	1	376	2	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.36e-75	4	366	2	366	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	4.41e-62	5	369	10	380	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	2.61e-45	1	311	2	286	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX64622.1	2.10e-236	1	375	1	375
BBK92630.1	6.01e-236	1	375	1	375
QUR47916.1	6.01e-236	1	375	1	375
ABR44355.1	1.72e-235	1	375	1	375
QRO15504.1	1.72e-235	1	375	1	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.79e-35	5	320	11	327	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.79e-35	5	320	11	327	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	1.86e-69	2	375	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q39T49	6.70e-63	2	375	8	380	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q2IL69	7.14e-62	2	376	10	383	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1
B8JE78	2.17e-60	2	376	10	383	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1
B4UHR6	1.19e-59	2	376	10	383	Lipid-A-disaccharide synthase OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000013	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002282_02732.