CAZyme Information: MGYG000002282_03594

Basic Information

• Species: Parabacteroides gordonii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides gordonii
• CAZyme ID: MGYG000002282_03594
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365	MGYG000002282_11|CGC1	41672.16	5.1048

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002282	6348794	Isolate	China	Asia

• Gene Location: Start: 64302; End: 65399 Strand: +

Full Sequence      

MCRHFLATLVVVLFMVSCGRPSPFRDKLYETMQTSLSWRNDTTGIWETAGWWNSANVLTA
TIRYAAVTGDTDVLPVIQDVYEKARRYQVGVDSTGTPRYCTNFINDYYDDEGWWALAWIE
ASKLTGEKKYLDMAEVIFDDMTTGWSEECGGGIFWKKNPLHYKNSIANNLFSLTAIRLYK
ATQNPSYLDWFKKNVAWYMQTGMINTDIYQIEDGTGKDCTPNRDAHYTYNQGVAIAVLTE
MYLVTNDNSYLELAEKIADATITTRLVTDEGILREMKPAIEHSNDGVQFKGIFIRHLAFL
YEVTKNPAYKDFIIKNAESILSKDYDPASKSFGCYWYGPFHRVSSAANACALECVIEAYS
LTKQF

Enzyme Prediction     

No EC number prediction in MGYG000002282_03594.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	35	348	1.6e-88	0.8519553072625698

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03663	Glyco_hydro_76	1.84e-49	51	299	35	290	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
COG4833	COG4833	7.04e-23	104	320	88	306	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
COG1331	YyaL	3.99e-05	110	327	274	507	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
COG4225	YesR	2.24e-04	224	323	31	114	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
cd04791	LanC_SerThrkinase	2.78e-04	115	261	92	234	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX66371.1	3.86e-242	1	364	1	364
QJE28248.1	2.07e-241	1	363	1	363
BBK90205.1	4.18e-241	1	363	1	363
QUR49840.1	1.70e-240	1	363	1	363
AST52979.1	1.98e-239	1	363	1	363

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K7X_A	3.85e-34	104	321	87	299	ChainA, Lin0763 protein [Listeria innocua]
6SHD_A	1.78e-28	25	320	62	348	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	6.47e-28	25	320	63	349	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	2.15e-26	25	320	63	349	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
4MU9_A	3.27e-21	107	357	116	361	Crystalstructure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482],4MU9_B Crystal structure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000039	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002282_03594.