CAZyme Information: MGYG000002282_04003

Basic Information

• Species: Parabacteroides gordonii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides gordonii
• CAZyme ID: MGYG000002282_04003
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1405	MGYG000002282_14|CGC1	158903.85	4.4274

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002282	6348794	Isolate	China	Asia

• Gene Location: Start: 1825; End: 6042 Strand: -

Full Sequence      

MMKKDLFIRILILWGLLTGFTEIHATGDVTGPVMSSDIVYTLPIEKVTPIYGSRYNGTIN
SFNINDNWGGKTTPSFALTEDDFNLIKLSNFDFHPLTFYGSPVDLSTATYINIDAFFSRD
VSTVGIKLYPSGDTDYEFTSNKTYKKGKWHSIQIPLNEFIRVKGDEALQKTTSMLLSVQG
DDVGVTAYLDNIYFSMEANEPIEIPAASTPERPSANVVNFYSTQYGTDTDLVFLDWGGKY
TVSKKNDSEDNELLKFSRFNWGAIQYDLNNQVLEIGNNNRFRLNVYSENALPAFKVILML
YENRIGNAENIEFETQASNLAANEWHSIDVDINDFLEKTERKISTIQIHTGSSNNTIYLN
HIYFYNDKDITPVESAPENMAYLPPVQLNPANVISIFSDSYTNGLSTGYPEVVDKGQTTV
EAIVRRGNNFFYQLTETDQFPLDLGNVDLSGMDSLHIDIYSPDATSLSITLDGGNKHSIP
VTLIPGEWNRMNFALSEFADVSLDDVDYLSLEGGNGKTFFIDNIYFFRKKELFTPTPIEN
LNKKLGKGINLGNIYDQSNLEWNDAYIAMVKEKGFTHVRLPIRWDNDGRSLNEEPYNIDE
AFMLKMKTVIDKILAADLKLVINMHHYNPLMELSGEEQTKEMERFLVLWAQIAEYFQNYP
EDLVFEILNEPRDNMTVALWNELLEKAINTIRVTNPNRAIMVGTTDWGTVYGLEGLKLPQ
DNHLILTVHYYNPMPFTHQGAEWSGNPPIGYKWYDSQSDRDAVINEFNLIRDFSAANNNI
PVHIGEFGTYDRADIDSRLLWTTFVTRTIEQYGYSYAYWDFGTDFGIYDVATGQFRQHLL
DALFTNKIPEKPMDFHIVGSETVYDSNINKGSNWNTGSIGYWTNSWDNGELTVSITNERE
NAWDVQPILITGIEEGAIYTVTFTVSGDTEGYTFSHYIGKSGAAYVPYGPNVSFSPKLQE
ETYSYTFTMLRETDNEARFTLDMGGQGTGRFTFKNISITKGFLAISSATIPKMSEPDVST
VFSSFYNNGLSTVAFPSMGGTIKGEEKDVKENEIIKLDNFDKQDVTLGTSLVLNDKDHLH
LDVYPRSGLKLVVTAGNEGTVQKYSYTLKPHTWNALDIDLTGLLAKTKGKIDNISLSCDL
GGRTLYLDHIYFYKKDSGTDPSEPEEPLAPSEAAPVPTQAANRVVSIFSDTYANIPYSFD
SQDGQTTEVDYVRINGNNTLRLTNTNILFINLDNVKVDHMEQLHLDVWTAETETFNLYLS
DGNYETPAINMSSRGEEWKSFNILLSDYEKYINLANLYSIRMEANRQSIYYVDNLYFYST
PPTDNSVIQQGSDITYKIQGNQLLLESQIPLQSVVVFDVTGRISSNIRTTAVCVTIDLNQ
LNSGVHFLQMVDSEGKMKTIKFVKR

Enzyme Prediction     

No EC number prediction in MGYG000002282_04003.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	561	821	1.1e-90	0.9732824427480916
CBM4	865	984	4e-16	0.9603174603174603

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	2.44e-44	564	822	27	269	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	4.24e-22	532	836	35	374	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
TIGR04183	Por_Secre_tail	1.76e-04	1341	1405	10	72	Por secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber average twenty or more copies of a C-terminal domain, represented by this model, associated with sorting to the outer membrane and covalent modification.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASB47982.1	8.72e-109	534	1007	22	497
AEW47975.1	1.08e-100	536	1000	53	518
QGY46710.1	5.00e-100	517	984	2	470
SMD42944.1	5.84e-98	536	1018	19	502
QRX63720.1	2.17e-96	541	998	68	526

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AMC_A	1.70e-78	537	843	5	310	Crystalstructures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMC_B Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMD_A Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_B Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_C Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_D Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3MMU_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_E Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_F Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_G Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_H Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima]
3AMG_A	1.10e-77	537	843	5	310	Crystalstructures of Thermotoga maritima Cel5A in complex with Cellobiose substrate, mutant form [Thermotoga maritima MSB8],3AMG_B Crystal structures of Thermotoga maritima Cel5A in complex with Cellobiose substrate, mutant form [Thermotoga maritima MSB8]
3AZR_A	1.10e-77	537	843	5	310	DiverseSubstrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellobiose [Thermotoga maritima MSB8],3AZR_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellobiose [Thermotoga maritima MSB8],3AZS_A Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Mannotriose [Thermotoga maritima MSB8],3AZS_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Mannotriose [Thermotoga maritima MSB8],3AZT_A Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_B Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_C Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8],3AZT_D Diverse Substrates Recognition Mechanism Revealed by Thermotoga maritima Cel5A Structures in Complex with Cellotetraose [Thermotoga maritima MSB8]
3AOF_A	2.80e-77	537	843	5	310	Crystalstructures of Thermotoga maritima Cel5A in complex with Mannotriose substrate [Thermotoga maritima MSB8],3AOF_B Crystal structures of Thermotoga maritima Cel5A in complex with Mannotriose substrate [Thermotoga maritima MSB8]
6KDD_A	5.09e-73	542	850	17	320	endoglucanase[Fervidobacterium pennivorans DSM 9078]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25472	2.67e-54	524	845	14	329	Endoglucanase D OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCD PE=3 SV=1
P16218	2.01e-46	543	844	334	629	Endoglucanase H OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celH PE=1 SV=1
P16169	1.39e-27	547	815	9	287	Cellodextrinase A OS=Ruminococcus flavefaciens OX=1265 GN=celA PE=3 SV=3
P10477	1.64e-25	540	822	59	352	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
P23661	5.83e-25	534	820	67	366	Endoglucanase B OS=Ruminococcus albus OX=1264 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000274	0.998532	0.000700	0.000178	0.000163	0.000152

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002282_04003.