CAZyme Information: MGYG000002283_00626

Basic Information

• Species: Bacillus_A paranthracis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae_G; Bacillus_A; Bacillus_A paranthracis
• CAZyme ID: MGYG000002283_00626
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
261		29079.37	9.8214

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002283	5102264	Isolate	China	Asia

• Gene Location: Start: 596975; End: 597760 Strand: +

Full Sequence      

MVVGNIVKEVLAYKKGQFQQKLSSPEAFVSSRFQEKLQSEPMKETKATTQPAKVEDMSQP
VQSTKIEAVVNKPEASIHKVEEVSKPEEKPETKKVDDVQVAQKEFERRFPETKNEAVDTW
GLTKKYNIQKIRSSNEGKYEDIIGRVSRTYGIPKTLIQKMIEVESDFNPKTVSHAGAMGL
MQLMPANVKEMGIKNPFSPAESIEGGVKELSGYLKKNNGDLVLALASYNAGPGNVRKYGG
VPPFKETQGYIKKILNIDVSK

Enzyme Prediction     

No EC number prediction in MGYG000002283_00626.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	155	257	6.5e-27	0.762962962962963

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	2.49e-48	156	255	3	107	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.06e-37	139	255	6	143	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	1.56e-34	138	255	3	141	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	2.93e-28	143	248	1	112	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13403	MLTF-like	8.48e-27	145	242	3	113	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAS40709.1	5.83e-178	1	261	1	261
QPI83241.1	9.66e-177	1	261	1	261
AFQ07938.1	1.37e-176	1	261	1	261
ARO17595.1	1.13e-175	1	261	1	261
AIY77543.1	1.13e-175	1	261	1	261

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QSA_A	4.29e-11	139	258	453	595	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
5MPQ_A	5.99e-10	139	255	416	549	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	6.01e-10	139	255	420	553	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	6.03e-10	139	255	426	559	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	6.05e-10	139	255	430	563	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	6.43e-38	123	257	45	178	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	1.33e-32	134	255	1417	1538	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	1.33e-32	134	255	1417	1538	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P27380	2.52e-13	141	257	9	121	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
Q30PQ0	8.48e-11	138	235	292	395	Membrane-bound lytic murein transglycosylase F OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) OX=326298 GN=mltF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002283_00626.