CAZyme Information: MGYG000002283_02412

Basic Information

• Species: Bacillus_A paranthracis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae_G; Bacillus_A; Bacillus_A paranthracis
• CAZyme ID: MGYG000002283_02412
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
575	MGYG000002283_1|CGC18	64028.84	6.0877

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002283	5102264	Isolate	China	Asia

• Gene Location: Start: 2327274; End: 2329001 Strand: -

Full Sequence      

MKKGFHNVLAASIVFSMVTIPNYSYANELGKTVTVSSEEQALKSIENHMKDEDGRGEDKG
VRSEVQGEFLVHIVKEVPLYDSSNFQKETGIRISNQVVKAEKRKGNAYYVQTSSGTGWIQ
NSDGNVEVKEIHPLLSEKLVINEESSTYSQPFTSYKEENVLEPQTIQAIGQAGEWFQVKI
NNEMKWIHSPSAKFEGTKASLIQDAAPTRTKRAAAMYAAPIEEKTTDIYGVPLKEMIVPK
GNENIRPGYAMNPKYITIHETDNYNVGANARNHAIYLYNQATGTEDRSASWHFTVDDKEI
YQHLPLNENAWHAGDGAEGTGNRESIAIEIAVNEDGDYNKAVENARKLAAYLMGELNIPL
ENVKKHQFWSGKICPAIMIKNNGWEPFLQGTKVYYDANHKDDISGGWYEADIRELDKRGI
MVGDGKGSYWPERLVTRGEFANLISRSLQLPEGSSNFNDLNTAHPSLIDGINRAASAGII
SGRGNGIFAPNDTIKRDEAVIMIDRALQYKKIKGNLVSLPFSDQDLAYDKQAVQRVYGLG
IVKGNENNEFMPKGSATRGESAAFINRMLKVIESK

Enzyme Prediction     

No EC number prediction in MGYG000002283_02412.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5632	CwlA	3.06e-37	230	391	1	165	N-acetylmuramoyl-L-alanine amidase CwlA [Cell wall/membrane/envelope biogenesis].
cd06583	PGRP	3.91e-27	252	378	1	126	Peptidoglycan recognition proteins (PGRPs) are pattern recognition receptors that bind, and in certain cases, hydrolyze peptidoglycans (PGNs) of bacterial cell walls. PGRPs have been divided into three classes: short PGRPs (PGRP-S), that are small (20 kDa) extracellular proteins; intermediate PGRPs (PGRP-I) that are 40-45 kDa and are predicted to be transmembrane proteins; and long PGRPs (PGRP-L), up to 90 kDa, which may be either intracellular or transmembrane. Several structures of PGRPs are known in insects and mammals, some bound with substrates like Muramyl Tripeptide (MTP) or Tracheal Cytotoxin (TCT). The substrate binding site is conserved in PGRP-LCx, PGRP-LE, and PGRP-Ialpha proteins. This family includes Zn-dependent N-Acetylmuramoyl-L-alanine Amidase, EC:3.5.1.28. This enzyme cleaves the amide bond between N-acetylmuramoyl and L-amino acids, preferentially D-lactyl-L-Ala, in bacterial cell walls. The structure for the bacteriophage T7 lysozyme shows that two of the conserved histidines and a cysteine are zinc binding residues. Site-directed mutagenesis of T7 lysozyme indicates that two conserved residues, a Tyr and a Lys, are important for amidase activity.
pfam01510	Amidase_2	1.51e-24	252	375	1	119	N-acetylmuramoyl-L-alanine amidase. This family includes zinc amidases that have N-acetylmuramoyl-L-alanine amidase activity EC:3.5.1.28. This enzyme domain cleaves the amide bond between N-acetylmuramoyl and L-amino acids in bacterial cell walls (preferentially: D-lactyl-L-Ala). The structure is known for the bacteriophage T7 structure and shows that two of the conserved histidines are zinc binding.
smart00644	Ami_2	2.70e-22	251	375	1	126	Ami_2 domain.
NF033190	inl_like_NEAT_1	2.25e-12	400	570	583	753	NEAT domain-containing leucine-rich repeat protein. Members of this family have an N-terminal NEAT (near transporter) domain often associated with iron transport, followed by a leucine-rich repeat region with significant sequence similarity to the internalins of Listeria monocytogenes. However, since Bacillus cereus (from which this protein was described, in PMID:16978259) is not considered an intracellular pathogen, and the function may be iron transport rather than internalization, applying the name "internalin" to this family probably would be misleading.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTR69063.1	7.97e-248	1	575	1	591
QTR76806.1	7.97e-248	1	575	1	591
QTR85044.1	1.60e-247	1	575	1	591
QTR73010.1	1.60e-247	1	575	1	591
QTR89055.1	1.60e-247	1	575	1	591

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3HMB_A	4.00e-49	231	390	5	155	ChainA, N-acetylmuramoyl-L-alanine amidase xlyA [Bacillus subtilis],3HMB_B Chain B, N-acetylmuramoyl-L-alanine amidase xlyA [Bacillus subtilis],3HMB_C Chain C, N-acetylmuramoyl-L-alanine amidase xlyA [Bacillus subtilis]
3RDR_A	5.82e-47	238	390	12	155	Structureof the catalytic domain of XlyA [Bacillus subtilis]
1YB0_A	7.86e-31	234	392	5	155	Structureof PlyL [Bacillus anthracis],1YB0_B Structure of PlyL [Bacillus anthracis],1YB0_C Structure of PlyL [Bacillus anthracis]
2L47_A	9.33e-31	233	392	3	155	Solutionstructure of the PlyG catalytic domain [Bacillus phage Gamma]
2AR3_A	5.44e-30	234	392	5	155	ChainA, prophage lambdaba02, n-acetylmuramoyl-l-alanine amidase, family 2 [Bacillus anthracis],2AR3_B Chain B, prophage lambdaba02, n-acetylmuramoyl-l-alanine amidase, family 2 [Bacillus anthracis],2AR3_C Chain C, prophage lambdaba02, n-acetylmuramoyl-l-alanine amidase, family 2 [Bacillus anthracis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54450	1.91e-46	231	390	2	153	N-acetylmuramoyl-L-alanine amidase CwlH OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlH PE=1 SV=1
P39800	1.87e-44	238	390	9	152	N-acetylmuramoyl-L-alanine amidase XlyA OS=Bacillus subtilis (strain 168) OX=224308 GN=xlyA PE=1 SV=1
P14892	4.39e-28	233	379	3	143	N-acetylmuramoyl-L-alanine amidase CwlA OS=Bacillus sp. OX=1409 GN=cwlA PE=3 SV=1
O34391	6.20e-27	231	385	3	151	N-acetylmuramoyl-L-alanine amidase XlyB OS=Bacillus subtilis (strain 168) OX=224308 GN=xlyB PE=3 SV=1
P24808	2.18e-26	237	384	9	150	N-acetylmuramoyl-L-alanine amidase CwlA OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000304	0.998932	0.000202	0.000183	0.000177	0.000159

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002283_02412.