CAZyme Information: MGYG000002283_03944

Basic Information

• Species: Bacillus_A paranthracis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae_G; Bacillus_A; Bacillus_A paranthracis
• CAZyme ID: MGYG000002283_03944
• CAZy Family: GH170
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361	MGYG000002283_3|CGC1	41213.92	5.208

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002283	5102264	Isolate	China	Asia

• Gene Location: Start: 57582; End: 58667 Strand: +

Full Sequence      

MERKLGISLYPEHSTKEKDMAYISAAARHGFSRIFTCLLSVNRPKEEIVAEFKEIIHHAK
DNNMEVILDVAPAVFDQLGISYSDLSFFAELGADGIRLDLGFDGLTEAKMTNNPYGLKIE
LNVSNDIAYLENILSHQANKSALIGCHNFYPQKFTGLPYDYFIRCSERFKKQGIRTAAFI
TSHAANIGPWDINDGLCTLEEHRNLPIEVQAKHLWATGLIDDVIIGNAYASEEELEKLGN
LNRYMLQLKVNFVDEATEVEKRATLQELHVRRGDITEYMVRSTEIRKKYKDYDFPVRESV
RQERGQVVIGNNSFGKYKGELQIILKEMPIDERKNIVGTIAEEELFLLDYVGAWTQFTCV
E

Enzyme Prediction     

No EC number prediction in MGYG000002283_03944.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH170	4	358	2.9e-124	0.9914285714285714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam19200	DUF871_N	4.19e-136	5	240	1	235	DUF871 N-terminal domain. This family consists of several conserved hypothetical proteins from bacteria and archaea. The function of this family is unknown.
COG3589	COG3589	1.54e-131	3	361	2	358	Uncharacterized protein [Function unknown].
pfam05913	DUF871	7.27e-44	246	357	1	113	Bacterial protein of unknown function (DUF871). This family consists of several conserved hypothetical proteins from bacteria and archaea. The function of this family is unknown.
cd00551	AmyAc_family	0.003	50	99	76	117	Alpha amylase catalytic domain family. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; and C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost this catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASZ15908.1	1.36e-265	1	361	1	361
QPI82429.1	1.36e-265	1	361	1	361
QHH83551.1	1.93e-265	1	361	1	361
QPA39910.1	7.84e-265	1	361	1	361
ACJ81968.1	7.84e-265	1	361	1	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1X7F_A	1.60e-262	1	361	25	385	Crystalstructure of an uncharacterized B. cereus protein [Bacillus cereus ATCC 14579]
2P0O_A	1.32e-29	6	360	6	358	Crystalstructure of a conserved protein from locus EF_2437 in Enterococcus faecalis with an unknown function [Enterococcus faecalis V583]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002283_03944.