CAZyme Information: MGYG000002284_01777

Basic Information

• Species: Megamonas funiformis
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Selenomonadaceae; Megamonas; Megamonas funiformis
• CAZyme ID: MGYG000002284_01777
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase BglA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
474	MGYG000002284_24|CGC1	54678.26	5.5133

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002284	2244659	Isolate	China	Asia

• Gene Location: Start: 16767; End: 18191 Strand: +

Full Sequence      

MGFPKGFLWGGAVAAHQLEGGWQEGGKGISVADVMTLGGPNKPREITDGVVPGKIYPNHE
AIDFYHRYEEDIALLAKMGFKCFRTSIAWTRIFPNGDEVEANEAGLKFYDDLFDTLHRYG
MEPIVTLSHFEMPYNLVTKYGGWRNRKLVDFFVRFAVTVFKRYKDKVKYWMTFNEINNQR
DVNTEFTAFTNSGVLYKDGENRYEVLYQVAHHEFVASALAVIEGHKINPDFQIGCMLAMS
PVYPATCKPMDQMAALKEMDRTFVFSDVQCRGHYPMYILKEWENKGYNIKIENGDFDILE
RGKVDYFALSYYMSFVSEYDPEGKEHMGKEVKNPYVKASDWGWQIDPVGLRYMLNVISER
YELPMMIVENGIGLHEYPDETGVVQDDTRIKYFSEHIAEMKKAVDEDGVTLMGYCPWGPI
DLVSASTGEMEKRYGFIYVDKNNQGKGTLKRVPKKSFYWYQKVIKTNGEDYSIE

Enzyme Prediction     

EC	3.2.1.86	3.2.1.23	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	3	468	1.4e-147	0.986013986013986

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	470	2	475	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	3	470	4	472	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	0.0	1	470	4	476	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	1	474	2	460	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	1	472	4	478	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BDA09399.1	0.0	1	474	1	474
QIB59260.1	0.0	1	474	1	474
SNV04822.1	0.0	1	473	1	473
BAL82170.1	5.25e-313	1	472	1	471
BAL81951.1	1.25e-282	1	470	1	474

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4F66_A	9.87e-226	4	470	8	479	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	2.82e-225	4	470	8	479	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
2XHY_A	7.18e-216	4	469	9	477	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
3PN8_A	7.45e-216	4	470	8	479	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]
3QOM_A	9.20e-210	3	470	11	479	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46829	3.93e-215	4	469	9	477	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P42973	2.47e-211	4	470	5	478	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
P40740	3.61e-189	3	469	8	467	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P24240	2.37e-166	3	470	4	472	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
Q46130	4.28e-164	1	469	5	469	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002284_01777.