CAZyme Information: MGYG000002285_01986

Basic Information

• Species: CAG-95 sp900066375
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-95; CAG-95 sp900066375
• CAZyme ID: MGYG000002285_01986
• CAZy Family: GH35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
863	MGYG000002285_8|CGC5	97851.61	5.196

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002285	3374269	Isolate	China	Asia

• Gene Location: Start: 167672; End: 170263 Strand: +

Full Sequence      

MEAIRLDQNGIYINGKYQTLLASSLFYFRIPRERWNDRMKLLKTAGYQAIDVYFPWNYHE
TAPDVWDFEGNKDVESFLKLAAENELFVIARPGPYICSEWDGGAIPAWLSEKKVAVRQDD
PGFLSEMRNWYAHILPVLSKYQIGQQGTIICMQIENELDFYRCTSPVSYMEKLKKMAEEF
GMTVPLFYCCGQNDLLRGGGLTPDLYTAYNVYSDGKNPDLEERAIHLYHAVQERSMPFLV
TETNREHSYLKRLLACGAKLLSPYNQTAGSTMDFYNGITNWGTEENPVALMASDYDFRSM
IGSAGECNEQIYQARLLAGLIRSLGESLATAKPGFHSELSVQSEGQINRKVPFLKLKEGE
LMELSNLERKQVITVHTEKDSFVVDMKPLETRLLPWNFHIGRECVIRHSNYEIGWISQQK
DRTKVCLYGEGLLDCLLDGAEGSSRIQKEMEEEEIVFSYGAVDFVAGSREHMGAARIPGL
PDLACLPEEQKDDGKEVTLYVGEAQLTKENSIKAEIAPMESLGQYRGIGCYDVTLAADGE
YLIAGAADLLTIRNQKSCETLYSNGNCLRRFFKKGEVQLQTEIWGHSNFDDIRCKSLQMG
SLKGISKLMRITRREDISESWLFDLDEGAFSETCFFRHSPYNTIMGIDGYNRAASPLKTI
YSRFVVSDKDEDALFLHFEKADCLIAVYVNNSLVSMVQKDDPYVDLSAFAGSGRIELTVR
ILRRYYTDLAGRVTLLGGKTIKECTYSELLPQAAKAFRNVELPLRLQKGENRFLKLQMQT
DKKEVKLFFKGKDLKLTVYAGGHVAGRILLQEENMPVVAGGNRDVVYLCGEWCGDVTIWC
QATGERPVLEDLRMAEYSSLQKN

Enzyme Prediction     

No EC number prediction in MGYG000002285_01986.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	12	317	5e-77	0.9837133550488599

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	3.40e-66	11	219	2	212	Glycosyl hydrolases family 35.
PLN03059	PLN03059	2.12e-26	3	395	29	407	beta-galactosidase; Provisional
COG1874	GanA	2.39e-14	12	163	9	166	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam02449	Glyco_hydro_42	7.91e-08	31	112	8	79	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNO18225.1	7.55e-159	1	833	1	840
AFH64881.1	5.37e-143	4	832	26	921
AEI44801.1	5.78e-143	4	832	29	924
ADQ06408.1	4.80e-138	4	828	7	883
ALS29487.1	1.90e-136	4	842	11	914

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7KDV_A	2.09e-40	14	326	28	346	ChainA, Beta-galactosidase [Mus musculus],7KDV_C Chain C, Beta-galactosidase [Mus musculus],7KDV_E Chain E, Beta-galactosidase [Mus musculus],7KDV_G Chain G, Beta-galactosidase [Mus musculus],7KDV_I Chain I, Beta-galactosidase [Mus musculus],7KDV_K Chain K, Beta-galactosidase [Mus musculus]
3THC_A	2.84e-38	1	315	8	328	Crystalstructure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_B Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_C Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_D Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THD_A Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_B Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_C Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_D Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens]
3WEZ_A	3.47e-38	1	315	32	352	Crystalstructure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_B Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_C Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_D Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WF0_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF1_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF2_A Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_B Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_C Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_D Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens]
4E8C_A	6.80e-38	8	305	7	313	Crystalstructure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8C_B Crystal structure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8D_A Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4],4E8D_B Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4]
3WF3_A	8.27e-38	1	315	32	352	Crystalstructure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_B Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_C Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_D Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF4_A Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_B Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_C Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_D Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23780	1.36e-39	14	326	45	363	Beta-galactosidase OS=Mus musculus OX=10090 GN=Glb1 PE=1 SV=1
Q58D55	4.66e-39	8	315	37	350	Beta-galactosidase OS=Bos taurus OX=9913 GN=GLB1 PE=2 SV=1
Q9TRY9	5.35e-39	4	315	35	352	Beta-galactosidase OS=Canis lupus familiaris OX=9615 GN=GLB1 PE=1 SV=3
P16278	1.89e-37	1	315	31	351	Beta-galactosidase OS=Homo sapiens OX=9606 GN=GLB1 PE=1 SV=2
O19015	2.36e-37	4	315	35	352	Beta-galactosidase OS=Felis catus OX=9685 GN=GLB1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002285_01986.