CAZyme Information: MGYG000002286_02551

Basic Information

• Species: Blautia stercoris
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia; Blautia stercoris
• CAZyme ID: MGYG000002286_02551
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
313	MGYG000002286_9|CGC1	36341.47	9.9776

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002286	3361914	Isolate	China	Asia

• Gene Location: Start: 14068; End: 15009 Strand: -

Full Sequence      

MRDLFENGKKPEVSVIIPAYRPGIKFERLLKKIQKQSYPVKEIIVMNTEKKYWNMDWEFV
NPNLKVYHIKKSEFDHGKTRAEAVKLSTGDIMVLFTQDAVPVDEFVIENLVKAFRNTKVG
AAYGRQLPNPECALIERYTRAFNYPDKSRLKGKADLDELGIKTFFCSNVCAAYRKDLYME
MGGFITHTIFNEDMIYAGKIVLKGYLVAYQADARVFHSHNYGNVEQFKRNFDLAVSQADH
PEIFKTVKSEKEGICLVKNTARYLCKIHKPWLVVDLVIKSGFKFLGYRTGKIYKRLPKKV
ILACTMNPSYWRK

Enzyme Prediction     

No EC number prediction in MGYG000002286_02551.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	14	180	3.4e-16	0.9823529411764705

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1215	BcsA	4.23e-17	2	216	45	263	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	6.42e-15	15	189	1	177	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
pfam00535	Glycos_transf_2	1.77e-12	14	178	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd02525	Succinoglycan_BP_ExoA	1.37e-09	13	217	2	207	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.
pfam13641	Glyco_tranf_2_3	1.90e-09	11	219	2	213	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBE96877.1	8.26e-152	13	311	6	304
QMW79879.1	8.26e-152	13	311	6	304
QIB57343.1	8.26e-152	13	311	6	304
ANU76706.1	3.89e-150	13	311	6	304
QQQ94283.1	3.89e-150	13	311	6	304

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26403	2.32e-59	12	311	2	302	O antigen biosynthesis rhamnosyltransferase RfbN OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfbN PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002286_02551.