CAZyme Information: MGYG000002288_05945

Basic Information

• Species: Bacillus_A luti
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae_G; Bacillus_A; Bacillus_A luti
• CAZyme ID: MGYG000002288_05945
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
146		16660.85	8.8647

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002288	5512240	Isolate	China	Asia

• Gene Location: Start: 171; End: 611 Strand: -

Full Sequence      

MWYEDIKGDSKYVTVAYNRFWDNGKASMCGMKSETGENWITYHHNWFDHSDSRMARVRTM
SVHMYNNYYQHCDVYGIGATSGSSIFMESNYFDAVKRPIMSSLQGTDAKGDGTFSGEKGG
LIKAYGNVFTNKMPRVMVLSLVRKVV

Enzyme Prediction     

No EC number prediction in MGYG000002288_05945.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	5	95	4e-28	0.4504950495049505

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3866	PelB	4.46e-26	5	99	180	280	Pectate lyase [Carbohydrate transport and metabolism].
smart00656	Amb_all	5.82e-20	5	96	96	190	Amb_all domain.
pfam00544	Pec_lyase_C	1.32e-13	5	92	119	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMP47052.1	1.33e-84	5	132	48	175
QNT67442.1	1.20e-79	5	132	370	497
QUB83317.1	2.97e-57	5	132	306	433
QCD40816.1	4.64e-57	5	132	345	472
QCP73706.1	4.64e-57	5	132	345	472

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VMV_A	1.24e-16	5	131	157	286	Crystalstructure of pectate lyase Bsp165PelA from Bacillus sp. N165 [Bacillus sp. N16-5],3VMW_A Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 in complex with trigalacturonate [Bacillus sp. N16-5]
1AIR_A	1.43e-12	5	105	170	270	ChainA, PECTATE LYASE C [Dickeya chrysanthemi],1O88_A Chain A, Pectate Lyase C [Dickeya chrysanthemi],1O8D_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8E_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8F_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8G_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8H_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8I_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8J_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8K_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8L_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8M_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1PLU_A Chain A, Protein (pectate Lyase C) [Dickeya chrysanthemi],2PEC_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi]
1VBL_A	2.18e-12	5	92	233	330	Structureof the thermostable pectate lyase PL 47 [Bacillus sp. TS-47]
2EWE_A	3.65e-12	5	105	170	270	ChainA, Pectate lyase C [Dickeya chrysanthemi]
3ZSC_A	7.09e-10	5	69	143	213	Catalyticfunction and substrate recognition of the pectate lyase from Thermotoga maritima [Thermotoga maritima]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B1B6T1	1.84e-14	5	101	184	281	Pectate trisaccharide-lyase OS=Bacillus sp. OX=1409 GN=pel PE=1 SV=1
Q65DC2	1.84e-14	5	101	184	281	Pectate trisaccharide-lyase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=BLi04129 PE=3 SV=1
Q8GCB2	1.84e-14	5	101	184	281	Pectate trisaccharide-lyase OS=Bacillus licheniformis OX=1402 GN=pelA PE=1 SV=1
P11073	8.24e-12	5	105	192	292	Pectate lyase C OS=Dickeya chrysanthemi OX=556 GN=pelC PE=1 SV=1
P0C1C3	1.84e-10	5	107	191	293	Pectate lyase 3 OS=Pectobacterium carotovorum subsp. carotovorum OX=555 GN=pel3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002288_05945.