CAZyme Information: MGYG000002291_00357

Basic Information

• Species: OM05-12 sp003438995
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; OM05-12; OM05-12 sp003438995
• CAZyme ID: MGYG000002291_00357
• CAZy Family: GH63
• CAZyme Description: Glucosidase YgjK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
639	MGYG000002291_1|CGC4	73156.38	4.9405

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002291	4475595	Isolate	China	Asia

• Gene Location: Start: 459753; End: 461672 Strand: +

Full Sequence      

MRKYIVATCLIVVIIALFNYCSDCSHKERSSLVHEYGDILDISYTPSDSTYCRGWFSDQG
SWMGFTIPQKEQWVNGFCGPFNLESRYWLSPSLVSVGFAGHMDAVFHPDSVSYFPGELYM
KSFSDAGTIAQRLLFVDKSNALLECTSEDNKPLCFYGQVLADKVSQNVMNNSYTFSLPSG
DQCLLTFPEDTKIRIYDGGYEATTPKGKHFYVVISFLNNPKGQVFDVNAIKDIQSQPTKY
IDKHYQCWDNYLKNVLRPDMPKEYNRIAVKAVVTLIANWRSSKGGLLHDGVVPSHAVGYF
MGFWAWDSWKHAVALASFAPELAKNQVRAMFDYQLDNGMIIDCIYPDIRENNARDSKPPL
AAWAVNEIFKETSDTSFVKEMYPQLLNYYRWWYTDRDHDSNGICEFGSVDGTLEAAAWES
GMDNAIRFDDAEMVKNSETAWSFDQESVDLNAFLAYEYSILRDLAVIAEQPFNEPDYTQE
ISAYFYDKDLGFFFDRKLNGKFVEEEGSEAYIPFWTGIASKEQMESAMKLFTDTAKFSTY
IPFPTVAADNPKFMPKGYWRGPIWLDQTYFAISGLRKYGYVEEADKYTRQVFDRLQGLKG
NGAIHENYGTHTGEQLKAPHFSWSSAHLLMLYKDYGKNK

Enzyme Prediction     

No EC number prediction in MGYG000002291_00357.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	208	635	7.3e-107	0.5350877192982456

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	5.05e-127	8	635	5	783	alpha-glucosidase; Provisional
COG3408	GDB1	6.47e-21	264	632	247	603	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam01204	Trehalase	1.05e-08	356	636	178	509	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
pfam03200	Glyco_hydro_63	6.76e-07	375	631	185	492	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
COG1626	TreA	1.77e-06	416	589	324	497	Neutral trehalase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT86878.1	1.13e-270	2	637	3	644
AND18792.1	6.51e-270	2	637	3	644
QJR62245.1	9.24e-270	21	637	22	644
QJR61716.1	9.24e-270	21	637	22	644
AII67042.1	9.24e-270	21	637	22	644

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	7.41e-79	56	635	32	756	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	3.84e-78	56	635	32	756	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	5.34e-78	56	635	32	756	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	1.04e-74	56	635	33	757	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
7PQQ_B	2.52e-40	56	409	358	769	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	6.16e-78	56	635	55	779	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8QTR2	1.36e-21	296	626	90	479	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	3.23e-21	296	626	90	479	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
Q04336	5.80e-09	100	465	259	640	Uncharacterized protein YMR196W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YMR196W PE=1 SV=1
K5BDL0	6.82e-07	290	629	26	442	Glucosylglycerate hydrolase OS=Mycolicibacterium hassiacum (strain DSM 44199 / CIP 105218 / JCM 12690 / 3849) OX=1122247 GN=ggh PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.007994	0.232239	0.758414	0.000444	0.000448	0.000451

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002291_00357.