CAZyme Information: MGYG000002291_00626

Basic Information

• Species: OM05-12 sp003438995
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; OM05-12; OM05-12 sp003438995
• CAZyme ID: MGYG000002291_00626
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
589	MGYG000002291_2|CGC5	65638.66	5.5705

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002291	4475595	Isolate	China	Asia

• Gene Location: Start: 322780; End: 324549 Strand: +

Full Sequence      

MFIYLYCLGAFSQDFDYPTAIQNIPAFPTAEGFGKFATGGRGGKVVTVTTLEDDTLNTSP
GSLRWAVNQYPNEPITIVFNVSGHIRLKKILSIRRTAGVTIAGQTAPGEGICISGHKVLL
GFSENMIIRNMRFRCGIGTDETGSAVGDQTLGAENIANVIIDHCSLGWSGEEMSTTSDSH
FITLQHCIVHEGLFRAGHHKGDRGYGICFGGSQATMHHCLLAHNNARTPRFSGAQSTDYV
AYVEYINNVNYNYINAAHGGEINVSNTKYHQSETNFVGNYYKPGPATLIYKPDKKKWNFF
NQTVDAPSMGKTIDIPKWYFAGNVMEGSDELTKDNWKGVTIDNTDYYTISEMRVDTFIQP
VNFFRKYKFDWKAYTMHDNIESAEKAFQTVLAKVGCVNRDSIERRIIRETKDGTATFGGV
KGAGLGIIDDPTNVEGGIGYIDYPSYTPRGGNYDTDGDGMPDEWEILKGLDPNNSEDRNY
VTPEGYTALEVYLCSLMGENIEGELSEPTSIKESHPMNFEYEIKDNVLILNSERPLVGLH
IFDMQGRCCIMEKLSGNYHHVNLSRLFDGTYILWVVDTEGYRSAVKFQK

Enzyme Prediction     

No EC number prediction in MGYG000002291_00626.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	82	281	7.3e-56	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3866	PelB	1.56e-08	1	306	10	298	Pectate lyase [Carbohydrate transport and metabolism].
smart00656	Amb_all	7.06e-05	85	235	4	155	Amb_all domain.
pfam18884	TSP3_bac	4.12e-04	454	475	1	22	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT77860.1	5.59e-146	22	589	416	969
QCD41735.1	2.06e-136	22	573	741	1277
QUT69799.1	5.63e-132	17	501	65	553
QCP72287.1	1.84e-131	24	575	760	1303
QCD38595.1	1.84e-131	24	575	760	1303

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1PXZ_A	6.13e-08	30	198	25	203	ChainA, Major pollen allergen Jun a 1 [Juniperus ashei],1PXZ_B Chain B, Major pollen allergen Jun a 1 [Juniperus ashei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B0XMA2	3.28e-36	5	497	8	415	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1
A1DPF0	3.28e-36	5	497	8	415	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1
Q4WL88	6.14e-36	5	497	8	415	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1
B8NQQ7	1.67e-33	24	497	20	414	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
Q5B297	2.07e-32	26	499	22	413	Probable pectate lyase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.716504	0.282837	0.000220	0.000186	0.000113	0.000141

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002291_00626.