CAZyme Information: MGYG000002291_00784

Basic Information

• Species: OM05-12 sp003438995
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; OM05-12; OM05-12 sp003438995
• CAZyme ID: MGYG000002291_00784
• CAZy Family: GH66
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1064	MGYG000002291_3|CGC1	119027.4	4.4666

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002291	4475595	Isolate	China	Asia

• Gene Location: Start: 102682; End: 105876 Strand: -

Full Sequence      

MKKKILMSSGLLCLFLSINAHDDLVYRTRSGWSFDIGSQAHISQTVDASFLGGACVGDYD
GDGLADLCEIKLDSENIQWVWKINKGKGNWIEESPISFGVSEADKCVVGDFNGDGKSDIA
VMRSGSGALATWYIDFSPCEGNFDAKGQFGLPGDIPLAGDFNGDGIDDIAVYRPSTGTWY
VAFSSLTGYPEFDMPLAINGVIFGTAEDIPFTGDFNGDGYTDMALYRSSTGQILINYWSA
DKPRFEHYADINGFGAVDRAITVPVSDVLSVMAADMDNSRPVTLPLATVEEMGKEVNLRH
GWTCIFDNSLDVDKWAHNLKAAGINTLEYHPWMRAHEEIAPQTETWNTYVGDDRLWTSKD
MMKKKIEKFRSIGGRSICYTGIYAATPAFAHDYPNWAMRNAADRSFITYGGSYLYLMSTN
ESVNAPYIINGDTYKNFNDYFVSQAVEAQREYNWDGYRWDWYGLPDSYVCDGTSITCNFS
NEMAPLVNRLDLAVKGERADVTTTALQLPSTNGNVPHYTTGAVANHQFMELWPFGTGTKY
TDLYRDIYEAKSRYPDKPVFANFYPPAEMNLKTSWPKQNIDYQFATCLSAGGYPAAQVVD
GVAGFTDPVPFHAVNYPVEVLERIARWNEFTEAYGGYLYYSNHAYVIADYNNSDLSLDDN
IAGVYAKLKKRWDKRTRRVDAMIINLINYGTTTELRWDAVNATPQSRAVGVSFTLPENVV
PTDLYCVTLEGRQKVNYVKEGTKIKVSLPTLDTFATLVLNLDNASGMLDEMDDDAMSFDI
FPFQYDAKGETLRPAQCDAVSVLDDQEPLIVANDYNGNISQTSIITDAFAGERALQVTPG
IIRFTTTSDGAIRVPIDQFNRFKIAIRSNNTTACWFGFRLIKPSDSSPVWETRDIFYRVG
YSQPGLAYLTLTPVKPIVGEWVEYERNIQQDLVKLWGEDWANAIVISVHLGPVDRNSADY
DNLIFMSEGYSGIDSIKKKDEAVSVYFDDEGCMQIVSGEMQEESLYEVRLVDLGGRICYK
SRTKFNNGVLSCHVPTLSQGAYLLTINDVEQRHFNQLYSSVIFR

Enzyme Prediction     

No EC number prediction in MGYG000002291_00784.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH66	310	705	9.3e-20	0.6762589928057554

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14745	GH66	1.53e-08	324	570	31	260	Glycoside Hydrolase Family 66. Glycoside Hydrolase Family 66 contains proteins characterized as cycloisomaltooligosaccharide glucanotransferase (CITase) and dextranases from a variety of bacteria. CITase cyclizes part of a (1-6)-alpha-D-glucan (dextrans) chain by formation of a (1-6)-alpha-D-glucosidic bond. Dextranases catalyze the endohydrolysis of (1-6)-alpha-D-glucosidic linkages in dextran. Some members contain Carbohydrate Binding Module 35 (CBM35) domains, either C-terminal or inserted in the domain or both.
pfam13517	VCBS	3.35e-07	58	121	1	61	Repeat domain in Vibrio, Colwellia, Bradyrhizobium and Shewanella. This domain of about 100 residues is found in multiple (up to 35) copies in long proteins from several species of Vibrio, Colwellia, Bradyrhizobium, and Shewanella (hence the name VCBS) and in smaller copy numbers in proteins from several other bacteria. The large protein size and repeat copy numbers, species distribution, and suggested activities of several member proteins suggests a role for this domain in adhesion (TIGR).
pfam13517	VCBS	5.30e-07	110	171	1	61	Repeat domain in Vibrio, Colwellia, Bradyrhizobium and Shewanella. This domain of about 100 residues is found in multiple (up to 35) copies in long proteins from several species of Vibrio, Colwellia, Bradyrhizobium, and Shewanella (hence the name VCBS) and in smaller copy numbers in proteins from several other bacteria. The large protein size and repeat copy numbers, species distribution, and suggested activities of several member proteins suggests a role for this domain in adhesion (TIGR).
pfam13517	VCBS	1.84e-04	160	225	1	61	Repeat domain in Vibrio, Colwellia, Bradyrhizobium and Shewanella. This domain of about 100 residues is found in multiple (up to 35) copies in long proteins from several species of Vibrio, Colwellia, Bradyrhizobium, and Shewanella (hence the name VCBS) and in smaller copy numbers in proteins from several other bacteria. The large protein size and repeat copy numbers, species distribution, and suggested activities of several member proteins suggests a role for this domain in adhesion (TIGR).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT75822.1	0.0	1	1064	9	1070
ADV78896.1	4.40e-11	306	698	111	488
ABY93935.1	4.44e-11	306	698	116	493
ABY92063.1	4.44e-11	306	698	116	493
ATF70697.1	1.39e-08	298	564	87	330

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000503	0.998477	0.000313	0.000249	0.000229	0.000214

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002291_00784.