CAZyme Information: MGYG000002291_01888

Basic Information

• Species: OM05-12 sp003438995
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; OM05-12; OM05-12 sp003438995
• CAZyme ID: MGYG000002291_01888
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1093	MGYG000002291_8|CGC5	125624.26	6.0657

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002291	4475595	Isolate	China	Asia

• Gene Location: Start: 123060; End: 126341 Strand: +

Full Sequence      

MKNKLLILTGLLLPLATVMAQDNDRYVMITNPDLTSINREAPRSTFTSYTSENAAIQNNR
KDGTYRLSLNGTWKFNYVEDFEKCPDDFMKVDFDDSKWADIKVPGNWERQGFGTPIYVNT
SYEFTSPAHIAPFWKKPNPPYIPKDWNPTGTYRREFNLPKDWDGKEIYLSADATKGAAFF
YLNGQFIGMNKESKTPARFNITKNVKIGKNVISVQIHRFSDANYLECQDFWRLSGFEREV
YLYAQPKVHIQNFFARTPLDAQYQNGIFNLSVDVINSNESPMTCVLAYNILDADGKSVAS
ANRKCTLTSTAKVEFDQNILKDVAAWTAETPNLYTLVISIKDENGKILEATSSKIGFRTV
EIKDKLLKVNGQAITVKGVNIHEHDEITGHYVTEELMRKDFELFKKYNVNTVRTSHYPQQ
ERFYELCDEYGFYVIDEANIESHGMGYNLKKGGTLGNNPLFLKAHQDRTISLFERDKNHP
SVIIWSLGNEAGNGINFYTTYNLLKQLDTRPIQYERAELEWNTDIFCPMYAHIDQMIKYA
VNPENDRPLIQCEYAHAMGNSLGNFQDYWDAIDKYYLLQGGCIWDWVDQGFLEKDKDGNK
YWAYGGDYGKIGTPSDGNFCINGMVYPDRTVKPQTEEMRKVYQNIKFINFDATKQTIDIR
NDFSFTNLSKYDFSYTVTANGKNISKEDFKLVLSPNATQTIQLENLPSTEAGPIEYHVLF
EAKIRNAEPFLPAGYVISHEQYSINPLEKASAGRMTPAKIDETDTQAILSGNNFKAIFDK
ESGMLISYKYNGKEYIYNQQGLHPSFWRAPIDNDYGAQLPKKFKVWRNISEAAPKAKDFQ
VTTKRGFYRESNPNGVPGNRNGRESQVTYSVVSCNYDYPEIDGTWYITYTVFDNGVIRVN
NEFIAKKPKVAMIPRVGLRMQVPVNYKQLTYYGRGPWENYCDRKTGAFIGEYDFDVNKMY
EPYLRPQENNHRTDVRWFTLKDKSGAGIMFIADNTFEINASSYPMETFDSGDDIYNEQPV
SETTCHRHINDPKPGEFVDVFIDYRMMGLGGDDSWGALLHEQYRINADQPISYGFSIVPF
GKKTDTKSLIKQY

Enzyme Prediction     

No EC number prediction in MGYG000002291_01888.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	54	949	4.6e-215	0.976063829787234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09525	lacZ	0.0	31	1069	19	1017	beta-galactosidase.
PRK10340	ebgA	0.0	31	1083	6	1003	cryptic beta-D-galactosidase subunit alpha; Reviewed
COG3250	LacZ	2.87e-153	66	950	12	807	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	4.68e-98	360	647	1	302	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
smart01038	Bgal_small_N	1.79e-91	770	1077	1	272	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT76488.1	0.0	1	1093	1	1075
QRQ47733.1	0.0	1	1093	1	1071
QUT47051.1	0.0	1	1093	1	1071
QDO70573.1	0.0	1	1093	1	1071
QPH56947.1	0.0	1	1093	1	1073

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S6Z_A	8.89e-244	67	1076	39	976	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	9.16e-244	67	1076	40	977	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
3DEC_A	8.16e-224	37	1050	15	969	ChainA, Beta-galactosidase [Bacteroides thetaiotaomicron VPI-5482]
3BGA_A	8.33e-220	65	1079	47	1000	Crystalstructure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],3BGA_B Crystal structure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
3MUY_1	2.89e-163	31	1067	18	1011	Chain1, Beta-D-galactosidase [Escherichia coli K-12],3MUY_2 Chain 2, Beta-D-galactosidase [Escherichia coli K-12],3MUY_3 Chain 3, Beta-D-galactosidase [Escherichia coli K-12],3MUY_4 Chain 4, Beta-D-galactosidase [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	5.02e-243	67	1076	40	977	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
O52847	5.21e-238	31	1079	23	1033	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
A5F5U6	3.53e-197	31	1063	15	1003	Beta-galactosidase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=lacZ PE=3 SV=2
Q9K9C6	1.60e-191	66	1077	45	1011	Beta-galactosidase OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=lacZ PE=3 SV=1
Q6LL68	6.90e-187	31	1078	14	1024	Beta-galactosidase OS=Photobacterium profundum (strain SS9) OX=298386 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000688	0.998222	0.000294	0.000279	0.000261	0.000241

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002291_01888.