CAZyme Information: MGYG000002291_02126

Basic Information

• Species: OM05-12 sp003438995
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; OM05-12; OM05-12 sp003438995
• CAZyme ID: MGYG000002291_02126
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
317	MGYG000002291_11|CGC1	35803.93	7.8363

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002291	4475595	Isolate	China	Asia

• Gene Location: Start: 47332; End: 48285 Strand: -

Full Sequence      

MSVRVFRLLLLFLCSSLCAEAEIKDTLVVAHDGSGKYDKIQDAIESIRAFMDYTVVVYVK
NGVYKEKVVVPSWIKNVIIVGEDAEKTILTYDDGANINKMGTFRSYTLKIEGSDITLKNI
TIENNAPKGTGQAVALHTEGDRLIFIGCRFLGNQDTVYTGAERTRLYFYKCYIEGTTDFL
FGPSTALFDFCQIHSKSNSYITAAATPKEVKYGYVFKNCRLTADNGVTKVYLGRPWRPYA
STIFMNCDFGKHICAAGWHNWKNPDNEKTARYAEFMNKGEGADTTGRVKWAKQLTKEEAL
LSIENIFGEDINWFPFK

Enzyme Prediction     

No EC number prediction in MGYG000002291_02126.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	27	299	5.3e-102	0.9548611111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02773	PLN02773	7.72e-84	27	299	7	287	pectinesterase
pfam01095	Pectinesterase	9.15e-77	28	300	3	287	Pectinesterase.
PLN02682	PLN02682	3.49e-70	26	315	70	368	pectinesterase family protein
PLN02432	PLN02432	1.12e-69	27	310	13	290	putative pectinesterase
COG4677	PemB	8.12e-60	28	298	85	392	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT41964.1	9.20e-158	9	317	11	322
CAW41305.1	1.52e-156	9	317	11	322
ALJ43642.1	1.52e-156	9	317	11	322
CBC06956.1	1.52e-156	9	317	11	322
QUT69789.1	1.52e-156	9	317	11	322

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	1.12e-43	28	290	6	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	9.01e-43	20	290	2	281	Pectinmethylesterase from Carrot [Daucus carota]
5C1E_A	4.95e-33	27	287	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	2.62e-32	27	287	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	5.77e-26	25	299	5	325	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	5.81e-62	29	299	9	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8GXA1	1.43e-53	23	315	254	558	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q8VYZ3	1.99e-52	35	313	94	380	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
Q9FM79	2.01e-51	23	309	78	375	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
P41510	5.23e-51	22	292	268	550	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000226	0.999113	0.000183	0.000157	0.000142	0.000133

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002291_02126.