CAZyme Information: MGYG000002291_02128

Basic Information

• Species: OM05-12 sp003438995
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; OM05-12; OM05-12 sp003438995
• CAZyme ID: MGYG000002291_02128
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
408	MGYG000002291_11|CGC1	47518.43	8.4578

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002291	4475595	Isolate	China	Asia

• Gene Location: Start: 49654; End: 50880 Strand: -

Full Sequence      

MKNGMNKTISKFLLLGAIFCSTQVFAQKSISDKLPWSIRMTESEMVRCPESWQLDFQPKL
KWDYCHGLELQAMLDVYDRYGDDSIYDYALAYADTMIMQDGNIKTYKLKEYNIDRLNSGK
FLFRIYEQSKNEKYKKALDLLRSQLDTHPRNDDGGFWHKKIYPHQMWLDGIYMGAPFYAE
YAYRNNRPQDYQDIINQFVTVARHTYDPVNDVFRHACDVSKQEKWADKMTGQSAHAWGRA
MGWYAMALVDVLDFIPKHEPKRDTLLVLLDKVAEQVKRLQDKKSGVWYQVLDRSGDKGNY
LESSASTMFVYTLFKAVRMGYIDKSYLNVAEKGYKGILKNFIEVDDKGLVTITKACAVAG
LGGKVYRMGDYDYYINEKIRDNDPKAVGPFIMASLEWERLHPSYTVLK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	55	399	2e-121	0.9819277108433735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	8.21e-126	36	400	1	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	3.08e-101	56	400	28	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO69177.1	1.13e-246	5	400	2	396
QUT93209.1	7.59e-245	5	400	2	396
ALJ61262.1	7.59e-245	5	400	2	396
QUT77882.1	7.94e-243	9	400	6	396
QQA07820.1	5.14e-232	11	400	8	397

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	5.80e-112	62	400	23	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	2.04e-78	55	403	32	370	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	8.52e-78	55	403	22	360	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	1.69e-17	45	340	48	331	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3K11_A	5.98e-17	153	400	186	413	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.12e-77	55	403	32	370	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.01e-40	173	396	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.01e-40	173	396	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003320	0.735422	0.259732	0.000924	0.000314	0.000254

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002291_02128.