CAZyme Information: MGYG000002291_02293

Basic Information

• Species: OM05-12 sp003438995
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; OM05-12; OM05-12 sp003438995
• CAZyme ID: MGYG000002291_02293
• CAZy Family: GH20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
773	MGYG000002291_13|CGC1	87360.37	5.1205

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002291	4475595	Isolate	China	Asia

• Gene Location: Start: 19739; End: 22060 Strand: +

Full Sequence      

MKQHIFIFLILITVFTSCKVAVTRDLDAQIVPEPEKMVLDKGEFVFSSKTTIAVDNSAQQ
SDVASQLAGLFEQSAGFVPKFVDDVSQADVAFVTDSTLKEEAYRLIVSADKVRIESSDSK
GAYYGVQTLRQLLPAELESPTVTKNVCWNVPVLTIEDSPRFEYRGLMLDVSRFFMPKETV
LKIINAAAMLKINKLHFHLVDDQGWRLEIKKYPKLTEVGAWRVYREGPFSLKKNPTAPGE
ETPVGGYYTQADIKEIVSFAAERQIEVIPEIEMPAHSNSALAAYPQYACPVIDHYISVLP
GMGGRNSNVVYCAGNDSVYAFLQDVLDEVLELFPSEYIHLGGDEANKEAWEKCPKCRARM
RKEGITNVEDLQGYFMDRMTKYVQSKGRTVIGWDEWTNSKVPEGAVIFGWQGLGTAGYKA
AQQGHKFVMTPSQILYLDYYQGPQWFEPRTYFGNNTMKKIYDYEPVQADWEAKAAENLLG
VQASMWTEFIESPEHVEYMVFPRVAALADIAWAQKGTKNWAGFLKRLDKLTKRWEYMGIG
YSKSMYNLDHVVKPENDELKVILSCTRPDVDIRYTLDGTSPTFASTLYTDTLVVTKNIVV
KAATFVGEESKGEVLTLDLKWNKATGKAVIGNTNPNVFLLTNGVRGTDKHTDFEWCGWYD
QNVSFTLDLGEEDTFDKVTLGHVVNYGMGVHYPKSIVLSVSDDNKQFKKIGTLSFTEKEI
FRDGIYMDEFKFDDLSSKGRYLKFDIASPGETPSFHHRAGQGVWLYFDEIGVY

Enzyme Prediction     

No EC number prediction in MGYG000002291_02293.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	156	514	2.1e-118	0.973293768545994

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06563	GH20_chitobiase-like	0.0	161	527	1	357	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
pfam00728	Glyco_hydro_20	1.21e-163	161	514	1	345	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
COG3525	Chb	1.44e-125	25	606	131	703	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
cd06568	GH20_SpHex_like	1.51e-94	161	527	1	329	A subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex). SpHex catalyzes the hydrolysis of N-acetyl-beta-hexosaminides. An Asp residue within the active site plays a critical role in substrate-assisted catalysis by orienting the 2-acetamido group and stabilizing the transition state. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself. Proteins belonging to this subgroup lack the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases.
cd06569	GH20_Sm-chitobiase-like	2.21e-83	157	535	1	439	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI61692.1	0.0	6	773	9	774
QUT71945.1	0.0	9	770	6	773
QUT39429.1	3.91e-317	9	770	6	773
ALJ41001.1	5.22e-317	9	770	6	773
AAO76734.1	5.22e-317	9	770	6	773

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q63_A	6.42e-137	16	772	18	773	BT0459[Bacteroides thetaiotaomicron],6Q63_B BT0459 [Bacteroides thetaiotaomicron],6Q63_C BT0459 [Bacteroides thetaiotaomicron]
7DUP_A	4.15e-104	32	550	8	529	ChainA, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_A Chain A, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_B Chain B, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron]
7DVB_A	2.26e-103	32	550	8	529	ChainA, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_B Chain B, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_C Chain C, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_D Chain D, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron]
3RCN_A	1.37e-99	29	541	9	513	CrystalStructure of Beta-N-Acetylhexosaminidase from Arthrobacter aurescens [Paenarthrobacter aurescens TC1]
7CBN_A	3.48e-98	31	543	14	512	Crystalstructure of beta-N-acetylhexosaminidase Am0868 from Akkermansia muciniphila [Akkermansia muciniphila ATCC BAA-835],7CBO_A Crystal structure of beta-N-acetylhexosaminidase Am0868 from Akkermansia muciniphila in complex with GlcNAc [Akkermansia muciniphila ATCC BAA-835]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49008	1.03e-117	25	589	32	582	Beta-hexosaminidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=nahA PE=3 SV=2
B2UQG6	2.59e-97	31	543	33	531	Beta-hexosaminidase Amuc_0868 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_0868 PE=1 SV=1
P96155	4.10e-85	30	508	141	601	Beta-hexosaminidase OS=Vibrio furnissii OX=29494 GN=exoI PE=1 SV=1
B2UP57	1.01e-72	97	536	54	475	Beta-hexosaminidase Amuc_2018 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_2018 PE=1 SV=1
Q04786	1.85e-59	89	512	253	717	Beta-hexosaminidase OS=Vibrio vulnificus OX=672 GN=hex PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000329	0.271941	0.727396	0.000106	0.000109	0.000104

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002291_02293.