CAZyme Information: MGYG000002291_02605

Basic Information

• Species: OM05-12 sp003438995
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; OM05-12; OM05-12 sp003438995
• CAZyme ID: MGYG000002291_02605
• CAZy Family: GH128
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
511	MGYG000002291_17|CGC1	57995.55	4.5026

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002291	4475595	Isolate	China	Asia

• Gene Location: Start: 32070; End: 33605 Strand: -

Full Sequence      

MNYIKLTVIAGCFLALQMNSFLFAQAKSYKRGVSYEIPYAEDVYSLSKGSSWFYNWGVTP
NAVVDAVLEDEAVDFVPMAWNGGYNENALRSYLQTHKNVKYLLGFNEPNFKSQANMTPAE
AVAAWPRLQKIADDFGLKIVAPAVNFSPDAPYQDPNAWLDEFFKLLPADARVDYVAVHCY
MPYPSALMWYISKFKKYGKPIWLTEFCAWDEFYNIPGDQPSNQMKFMVNAINYLESDPDV
YRYAWFIPRTGGNDKYPYMQFLEDNAPGALTDLGQVFVNMSSQDKSYYFKVGEQIPAEHY
SSMNIVDIDNSDNWKDGFQLRLSTDDNGILEIYDFNDNEWAEYNIDVPSSGDFQIKLRYA
SKEDASCQLSVGGTELSVLSMPSTGGEKVWKEYQATLNLQKGEQTLRLKVTNGTISLNWL
TLLSGSSTHNDLLEMASTVSVYPSPVKDIMSIRSGDRRVNNLKIYELSGRMLAELKIESN
DVNLSFLPAGTYFLNIEMEDGISCVKKIVKY

Enzyme Prediction     

No EC number prediction in MGYG000002291_02605.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	47	277	4.7e-64	0.96875
CBM6	316	422	3e-18	0.7898550724637681

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam11790	Glyco_hydro_cc	8.92e-67	38	277	3	235	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.
cd04080	CBM6_cellulase-like	1.58e-20	295	422	5	143	Carbohydrate Binding Module 6 (CBM6); appended to glycoside hydrolase (GH) domains, including GH5 (cellulase). This family includes carbohydrate binding module 6 (CBM6) domains that are appended to several glycoside hydrolase (GH) domains, including GH5 (cellulase) and GH16, as well as to coagulation factor 5/8 carbohydrate-binding domains. CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. The CBM6s are appended to GHs that display a diversity of substrate specificities. For some members of this family information is available about the specific substrates of the appended GH domains. It includes the CBM domains of various enzymes involved in cell wall degradation including, an extracellular beta-1,3-glucanase from Lysobacter enzymogenes encoded by the gluC gene (its catalytic domain belongs to the GH16 family), the tandem CBM domains of Pseudomonas sp. PE2 beta-1,3(4)-glucanase A (its catalytic domain also belongs to GH16), and a family 6 CBM from Cellvibrio mixtus Endoglucanase 5A (CmCBM6) which binds to the beta1,4-beta1,3-mixed linked glucans lichenan, and barley beta-glucan, cello-oligosaccharides, insoluble forms of cellulose, the beta1,3-glucan laminarin, and xylooligosaccharides, and the CBM6 of Fibrobacter succinogenes S85 XynD xylanase, appended to a GH10 domain, and Cellvibrio japonicas Cel5G appended to a GH5 (cellulase) domain. GH5 (cellulase) family includes enzymes with several known activities such as endoglucanase, beta-mannanase, and xylanase, which are involved in the degradation of cellulose and xylans. GH16 family includes enzymes with lichenase, xyloglucan endotransglycosylase (XET), and beta-agarase activities. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. For CmCBM6 it has been shown that these two binding sites have different ligand specificities.
smart00606	CBD_IV	5.09e-12	295	422	8	129	Cellulose Binding Domain Type IV.
cd04082	CBM35_pectate_lyase-like	2.24e-11	333	413	30	113	Carbohydrate Binding Module family 35 (CBM35), pectate lyase-like; appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. This family includes carbohydrate binding module family 35 (CBM35) domains that are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. Included in this family are CBM35s of pectate lyases, including pectate lyase 10A from Cellvibrio japonicas, these enzymes release delta-4,5-anhydrogalaturonic acid (delta4,5-GalA) from pectin, thus identifying a signature molecule for plant cell wall degradation. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. Some CBM35s bind their ligands in a calcium-dependent manner, especially those binding uronic acids.
pfam03422	CBM_6	9.19e-11	297	422	2	123	Carbohydrate binding module (family 6).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU93826.1	3.63e-110	25	420	49	439
QKX17146.1	1.86e-95	23	456	736	1147
ARU26557.1	5.54e-93	24	420	111	495
QHQ40263.1	1.06e-92	23	469	737	1148
ARU27479.1	1.48e-90	23	426	731	1117

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UAV_A	1.11e-54	27	280	2	256	Crystalstructure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Pseudomonas viridiflava (PvGH128_II) [Pseudomonas viridiflava]
6UAW_A	2.17e-54	27	280	24	278	Crystalstructure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Pseudomonas viridiflava (PvGH128_II) in complex with laminaritriose [Pseudomonas viridiflava]
6UAX_A	1.91e-43	24	279	89	344	Crystalstructure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56],6UAX_B Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56]
6UAQ_A	1.65e-20	49	246	44	235	Crystalstructure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei],6UAR_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaritriose [Amycolatopsis mediterranei]
6UFL_A	4.14e-20	49	246	44	235	Crystalstructure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) in the complex with laminarihexaose [Amycolatopsis mediterranei],6UFZ_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q09788	2.11e-16	28	279	294	530	Alkali-sensitive linkage protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=asl1 PE=1 SV=1
Q27082	5.57e-09	319	455	425	573	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000593	0.998677	0.000223	0.000184	0.000149	0.000144

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002291_02605.