CAZyme Information: MGYG000002291_02777

Basic Information

• Species: OM05-12 sp003438995
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; OM05-12; OM05-12 sp003438995
• CAZyme ID: MGYG000002291_02777
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376	MGYG000002291_20|CGC1	42730.86	8.7298

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002291	4475595	Isolate	China	Asia

• Gene Location: Start: 18914; End: 20044 Strand: -

Full Sequence      

MKYYLIVGEASGDLHASNLMHALKQEDPEAEFRFFGGDLMSAQGGIRVKHYRELAYMGFI
PVLLHLRTIFANMKYCKEDILRFAPDVVILVDYPGFNLSIAKFIKKNTRIPVYYYISPKI
WAWKEYRIKSIKRDVDEMFSILPFEVDFYKGHQYPIHYVGNPCVDSVAAFKEEHKETKED
FLAKNGLGNKPIIALLAGSRKQEIKNNLPLMLEASTAFPDYQFVLAGAPGIEHEYYKQFI
GDAGVKVVFDRTYALLSYADAALVTSGTATLETALFRVPQVVCYYMAAGKFISFLKKMVL
KVQFVSLVNLIAGKEVVKELVAGTMTVNNVKEELSKILYDEKYRADMLQEYDRIIRILGS
AGASEHAAKEMVRLLK

Enzyme Prediction     

No EC number prediction in MGYG000002291_02777.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	356	2.5e-116	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	7.58e-103	1	376	2	376	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.86e-96	1	376	2	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	5.06e-73	4	341	2	342	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	5.06e-64	5	374	10	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	2.41e-52	1	351	2	331	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT59470.1	5.34e-200	1	376	1	378
QQY41518.1	5.34e-200	1	376	1	378
QQY38221.1	2.17e-199	1	376	1	378
ABR39591.1	2.17e-199	1	376	1	378
QEW38059.1	3.08e-199	1	376	1	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	6.54e-36	5	374	11	380	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.75e-35	5	374	11	380	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	2.20e-67	2	375	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	4.11e-64	5	376	8	379	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
B3E4H8	7.56e-61	2	368	8	373	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q39T49	7.76e-61	2	375	8	380	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q6ALW0	6.33e-60	5	368	14	379	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002291_02777.