CAZyme Information: MGYG000002291_03421

Basic Information

• Species: OM05-12 sp003438995
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; OM05-12; OM05-12 sp003438995
• CAZyme ID: MGYG000002291_03421
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365	MGYG000002291_36|CGC1	41497.78	5.4932

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002291	4475595	Isolate	China	Asia

• Gene Location: Start: 6742; End: 7839 Strand: -

Full Sequence      

MKQRLCLVLMIFALIACNEQKSSKMLDDSKRSKAQELVSVLNVRKAKGIMLGHQDALAYG
SMWYGEKGRSDVKSVCGDYPAVVGWDIANVELGEALNIDSVKFQTIVEYIQITNEMGGVS
TISWTARNPVEDSAVQDPVSAILTQKKYKDKYVSYLDKLAAFFIDLKDKEGNHIPVIFRP
FHNPNVETYWWNINSCTTAEYKKLWQMTVDYLRKMKKVDNLVFALSLYNPLSTEEILNCY
PGDEYVDIIGSDLYLEQANDPMGKMYVENLNKTLAVITDVSDKKNKIPALTDTGMEGIKI
PNFFSELVYPVISEYPISYILFGKNAWNIENYYHIPIPGHPASEDFLKFVEIPRILTCNK
LDNKG

Enzyme Prediction     

EC	3.2.1.-	3.2.1.100

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	29	294	3.9e-51	0.8184818481848185

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	3.79e-32	34	306	9	282	Glycosyl hydrolase family 26.
COG4124	ManB2	3.56e-12	86	260	120	262	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK53347.1	3.93e-100	1	356	1	367
QIK58764.1	1.11e-99	1	356	1	367
AHF13854.1	1.49e-97	7	364	11	362
AIA99594.1	3.09e-95	14	356	7	361
BCI64729.1	8.46e-93	3	356	2	364

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZXO_A	3.56e-80	33	356	8	334	Thestructure of a GH26 beta-mannanase from Bacteroides ovatus, BoMan26A. [Bacteroides ovatus]
2VX4_A	4.13e-56	25	356	33	386	CellvibrioJaponicus Mannanase Cjman26c Native Form [Cellvibrio japonicus],2VX6_A CELLVIBRIO JAPONICUS MANNANASE CJMAN26C Gal1Man4-BOUND FORM [Cellvibrio japonicus]
2VX5_A	4.13e-56	25	356	33	386	CellvibrioJaponicus Mannanase Cjman26c Mannose-Bound Form [Cellvibrio japonicus]
4CD4_A	7.15e-56	25	356	56	409	Thestructure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManIFG [Cellvibrio japonicus Ueda107],4CD5_A The structure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManMIm [Cellvibrio japonicus Ueda107]
2VX7_A	1.60e-55	25	356	33	386	CellvibrioJaponicus Mannanase Cjman26c Mannobiose-Bound Form [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1A278	4.18e-31	69	360	84	397	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
P49424	4.76e-30	3	297	14	325	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
O05512	1.45e-15	72	328	79	329	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2
P16699	3.91e-10	73	331	82	336	Mannan endo-1,4-beta-mannosidase A and B OS=Caldalkalibacillus mannanilyticus (strain DSM 16130 / CIP 109019 / JCM 10596 / AM-001) OX=1236954 PE=1 SV=1
P49425	9.78e-10	27	294	148	408	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000001	0.000682	0.999355	0.000000	0.000001	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002291_03421.