CAZyme Information: MGYG000002292_00870

Basic Information

• Species: TF01-11 sp003529475
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; TF01-11; TF01-11 sp003529475
• CAZyme ID: MGYG000002292_00870
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318	MGYG000002292_3|CGC4	36582.02	4.5724

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002292	3137432	Isolate	China	Asia

• Gene Location: Start: 154674; End: 155630 Strand: -

Full Sequence      

METALLDTIPVNSNATPEARELLQYLARCSGTSILTGQHTQTNPMEEYQYIHEVTGHYPK
VVGFEMLSYSGNINWEDASEACLTEVRENQHTMETALALATQKDVILTICFHWFSPMGGR
DKAFYTEHTDFDPTKILQEGSAEEAAFYRDLKSIGEELRKFAEAGIPILWRPFHEVEGTW
FWWGSKGGEVAAKLYRKMYHYFVDELALNNLLWVWSAPTKEAYPGDEYVDVIGWDIYLPE
KKATDYSSYYEELRANTTTHKVAALTEVGYDPDVALLARSHVPWAYYMTWSKEFCLGEQY
NTKEELRALYGSEYAIKN

Enzyme Prediction     

No EC number prediction in MGYG000002292_00870.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	11	317	8.4e-94	0.9867986798679867

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	3.96e-48	11	316	1	307	Glycosyl hydrolase family 26.
COG4124	ManB2	1.98e-18	123	237	136	256	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK82137.1	1.01e-138	12	316	6	310
QNM01251.1	4.60e-135	15	316	13	332
AEB13973.1	4.26e-125	12	316	6	308
AZK45707.1	3.45e-112	5	316	1	312
AOZ93051.1	5.82e-109	7	316	6	315

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPF_A	3.93e-55	8	316	4	305	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3WDQ_A	1.32e-49	6	316	30	347	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
3ZM8_A	1.67e-49	12	316	147	442	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6Q75_A	2.25e-38	10	316	23	322	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
6HF2_A	1.77e-37	1	290	36	314	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5AWB7	6.17e-51	8	313	26	342	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
G2Q4H7	8.01e-47	12	316	176	471	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P49425	5.19e-43	12	294	148	433	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
A2R6F5	3.36e-38	11	316	29	328	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
P55297	8.65e-36	3	310	151	450	Mannan endo-1,4-beta-mannosidase B OS=Piromyces sp. OX=45796 GN=MANB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002292_00870.