CAZyme Information: MGYG000002293_00599

Basic Information

• Species: Prevotella sp900557255
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900557255
• CAZyme ID: MGYG000002293_00599
• CAZy Family: GH5
• CAZyme Description: Endoglucanase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406	MGYG000002293_4|CGC1	46117.89	6.3414

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002293	3611909	Isolate	China	Asia

• Gene Location: Start: 63298; End: 64518 Strand: -

Full Sequence      

MKRNFLKFSLFLIGVFTCLSCEASTLHSSSSSDGVGESIPTAQQWNKDVVGWNLGNEFEC
SAPGQDGESMQIGNPDGSIHAETAWGNPVVTKKMIQAVKKAGFNAIRIPIRWQCHITNAQ
AMSIDKAWIARIKEVVGWCLDNGLKVIINVHHEKWLEGRPTYQYKEENCQKLALLWMNIA
SEFANYDSRLAFAGTNEVHIRDNWGKPSAENLEVQNAYNQIFVDMVRATGGNNAKRHLIL
QTYVCNPWFGIENGDFIIPKDAEGNGNNYMSVEFHYYQPWSYAGDCTYDYWGDAYKDAGK
IPAENEKTMTDFFDKAVNTWSNKGLGIVIGEWGVTDHYKSNSEKVHENMTYYCKFLTTEA
RKRGFSTFVWDNNYFGNGSEKYGIFDRFKSMKVNAPWILEGIFGKE

Enzyme Prediction     

No EC number prediction in MGYG000002293_00599.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	82	373	4.1e-87	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	4.43e-47	82	376	16	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	2.49e-19	50	389	53	377	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT65075.1	0.0	1	406	1	406
QUB91389.1	9.35e-293	1	406	1	404
ASE18437.1	2.20e-291	1	406	1	404
ADK97059.1	2.20e-291	1	406	1	404
AKU68585.1	7.36e-290	1	406	1	404

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EDG_A	8.37e-65	50	402	31	371	SingleCrystal Structure Determination Of The Catalytic Domain Of Celcca Carried Out At 15 Degree C [Ruminiclostridium cellulolyticum H10]
4IM4_A	1.79e-57	50	402	16	331	ChainA, Endoglucanase E [Acetivibrio thermocellus],4IM4_B Chain B, Endoglucanase E [Acetivibrio thermocellus],4IM4_C Chain C, Endoglucanase E [Acetivibrio thermocellus],4IM4_D Chain D, Endoglucanase E [Acetivibrio thermocellus],4IM4_E Chain E, Endoglucanase E [Acetivibrio thermocellus],4IM4_F Chain F, Endoglucanase E [Acetivibrio thermocellus]
6PZ7_A	4.85e-57	41	398	8	325	GH5-4broad specificity endoglucanase from Clostridium acetobutylicum [Clostridium acetobutylicum ATCC 824]
4YHE_A	1.97e-56	50	386	16	347	NativeBacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a],4YHE_B Native Bacteroidetes-affiliated Gh5 Cellulase Linked With A Polysaccharide Utilization Locus [Bacteroidetes bacterium AC2a]
4X0V_A	6.46e-56	42	402	40	391	Structureof a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_B Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_C Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_D Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_E Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_F Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_G Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32],4X0V_H Structure of a GH5 family lichenase from Caldicellulosiruptor sp. F32 [Caldicellulosiruptor sp. F32]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P17901	5.02e-63	50	402	56	396	Endoglucanase A OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCA PE=1 SV=1
P28621	9.45e-56	41	400	41	368	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1
P28623	1.27e-54	7	400	10	366	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2
P10477	1.47e-53	50	402	66	381	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
P54937	7.39e-52	1	387	1	360	Endoglucanase A OS=Clostridium longisporum OX=1523 GN=celA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000786	0.301064	0.697218	0.000438	0.000270	0.000206

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002293_00599.