CAZyme Information: MGYG000002293_00667

Basic Information

• Species: Prevotella sp900557255
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900557255
• CAZyme ID: MGYG000002293_00667
• CAZy Family: GH63
• CAZyme Description: Glucosidase YgjK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
626	MGYG000002293_4|CGC3	71597.98	6.4397

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002293	3611909	Isolate	China	Asia

• Gene Location: Start: 147656; End: 149536 Strand: -

Full Sequence      

MKTKSIAILTMGLAMLSMDGMAQTTRQEYKDILDIQLTPGAPRRQNGCFTDMGSWMGFTL
SEKEKPTAGFCGPFSIYYRNWYARSLVSLIDGTVQEQSYYPGEIRMSLKKDGADFYESLQ
FVDARTALLTVTNPSKVPFTFTADSISTRANVSRYKNRVTIGDFYGERVIIDFPQEVKVT
DTDHNYLAAVPRGVEQLTIAISLVEQDTEASVQHVHTASLLANPKVALDENEKRWNGYLK
KVIRDDMPAEYNRVAAKSIVTLLSNWRAKRGALYHDGIVPSHAVGYFVGCWAWDCWRFSA
GMASFFPELAKDNIRVMFDYQQPDGMIIDCIYPDASENNYRDSKPPLAAWAVNEIYEHTQ
DLAFVKEMYPKLLKYHKWWYEKRDHDKNHICEFGSVDGTLEAAAWESGMDNAIRFDGTKM
LQNGKDAWSTDQESVDLNAYLSLEYTLLKKFAGLLGETFDLPDYRGLVADYFFDQKDGFF
YDRRLDADRSFVREAGCEGYIPFWANIATPKQFAKARKLLDNKKKFSTFIPFPTIAADNP
KYNPQGYWRGPIWLDQTYYGIKGYRNYGEKKKADAYTDQVFRNLQGISAGTPIYENYDTH
TGKPMQASHFSWSAACLIMMYNDYGK

Enzyme Prediction     

No EC number prediction in MGYG000002293_00667.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	190	624	5.3e-107	0.543859649122807

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	2.46e-131	1	624	1	783	alpha-glucosidase; Provisional
COG3408	GDB1	1.27e-20	276	621	270	603	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam01204	Trehalase	5.66e-09	343	625	178	509	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
pfam03200	Glyco_hydro_63	1.23e-08	362	620	185	492	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
PLN02567	PLN02567	1.86e-04	343	379	203	239	alpha,alpha-trehalase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT67704.1	0.0	1	626	1	626
QUT89313.1	8.54e-252	26	626	32	642
QQY39153.1	8.04e-248	26	626	34	644
ABR39053.1	8.04e-248	26	626	34	644
ALJ59646.1	1.06e-247	26	626	32	642

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	7.57e-78	49	624	32	756	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	3.92e-77	49	624	32	756	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	5.45e-77	49	624	32	756	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	2.84e-74	49	624	33	757	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
7PQQ_B	2.44e-33	402	624	42	305	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	6.25e-77	49	624	55	779	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8QTR2	4.09e-19	283	621	90	486	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	7.26e-19	283	623	90	488	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
P53008	8.84e-09	364	614	540	824	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000293	0.999018	0.000184	0.000178	0.000161	0.000146

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002293_00667.