CAZyme Information: MGYG000002293_00699

Basic Information

• Species: Prevotella sp900557255
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900557255
• CAZyme ID: MGYG000002293_00699
• CAZy Family: CE1
• CAZyme Description: Carbohydrate acetyl esterase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401	MGYG000002293_5|CGC1	44402.9	8.9798

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002293	3611909	Isolate	China	Asia

• Gene Location: Start: 38667; End: 39872 Strand: -

Full Sequence      

MKRFSILAITLCAFCGSASAQQALFGGQMPQSPEIHADKTVTFRCMAPEAHKVQITGDFL
PTKKVDTPMGKYDMPGVADLKKDEKGVWSFTTTAPLAPELYSYTMMVDGASVTDHLNVYT
VRDIANVSNYFLIGGGKADLYKVNKVAHGTVSKVWYDDAKAGLTRRMTVYTPAGYETSKQ
KYPVLYLLHGIGGDEEAWMDLGRASQILDNLIAQGKAKPMIVVMTNGNISQEAAPGQTSD
NLIVPTLGLPKTMEGSFEVSFPEVVKFVDARYRTLANSQNRAIAGLSMGGFHSLYISINN
PKTFGYVGLFSAAIGKEQRSGGANEYIYDNFDKKLADLFAAKPKLFWIGIGNTDFLFKDN
TALREKLTKNHYPFTYMETDGGHIWRNWRIYLGEFAQKIFK

Enzyme Prediction     

No EC number prediction in MGYG000002293_00699.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	162	397	2.4e-54	0.9515418502202643

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	1.04e-36	90	401	12	297	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
cd11294	E_set_Esterase_like_N	2.17e-30	39	134	1	83	N-terminal Early set domain associated with the catalytic domain of putative esterases. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
pfam00756	Esterase	1.79e-23	161	389	2	236	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
cd02858	E_set_Esterase_N	3.73e-13	40	114	2	59	N-terminal Early set domain associated with the catalytic domain of esterase. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
COG0627	FrmB	1.71e-12	168	395	38	304	S-formylglutathione hydrolase FrmB [Defense mechanisms].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH16110.1	1.31e-190	2	401	3	398
ADE82534.1	2.49e-184	1	401	1	401
AGH13470.1	2.99e-183	1	401	1	402
AHF26056.1	3.10e-183	1	401	1	403
ADY36651.1	3.17e-179	1	401	1	397

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RZN_A	1.58e-105	32	401	24	386	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
7B5V_A	1.60e-56	31	401	38	386	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6NE9_A	1.66e-48	33	401	42	382	ChainA, Isoamylase protein [Bacteroides intestinalis],6NE9_B Chain B, Isoamylase protein [Bacteroides intestinalis]
6MOT_A	3.24e-44	33	401	19	359	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]
6MOU_A	5.28e-44	33	401	40	380	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393],6MOU_B Chain B, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P31471	9.69e-39	6	401	5	389	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
D5EXZ4	1.33e-35	33	401	329	670	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
D5EY13	1.85e-32	33	401	395	726	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P10478	5.73e-28	144	397	44	274	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
P51584	3.66e-08	164	340	840	995	Endo-1,4-beta-xylanase Y OS=Acetivibrio thermocellus OX=1515 GN=xynY PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000346	0.997452	0.001578	0.000253	0.000176	0.000156

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002293_00699.