dbCAN-seq: a database of CAZyme sequence and annotation

You are browsing environment: HUMAN GUT

help

CAZyme Information: MGYG000002295_00247

You are here: Home > Sequence: MGYG000002295_00247

Basic Information help

Species

Ruminococcus_C callidus

Lineage

Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_C; Ruminococcus_C callidus

CAZyme ID

MGYG000002295_00247

CAZy Family

GH73

CAZyme Description

hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
397		42831.46	4.3569

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002295	2957494	Isolate	China	Asia

Gene Location

Start: 270296; End: 271489 Strand: +

Full Sequence Download help

Enzyme Prediction help

No EC number prediction in MGYG000002295_00247.

CAZyme Signature Domains help

Family	Start	End	Evalue	family coverage
GH73	263	392	5.2e-16	0.953125

CDD Domains download full data without filtering help

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5263	COG5263	4.14e-16	54	221	164	309	Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism].
NF033840	PspC_relate_1	6.44e-16	22	172	495	637	PspC-related protein choline-binding protein 1. Members of this family share C-terminal homology to the choline-binding form of the pneumococcal surface antigen PspC, but not to its allelic LPXTG-anchored forms because they lack the choline-binding repeat region. Members of this family should not be confused with PspC itself, whose identity and function reflect regions N-terminal to the choline-binding region. See Iannelli, et al. (PMID: 11891047) for information about the different allelic forms of PspC.
COG5263	COG5263	6.26e-15	49	206	87	254	Glucan-binding domain (YG repeat) [Carbohydrate transport and metabolism].
TIGR04035	glucan_65_rpt	4.01e-14	54	120	2	62	glucan-binding repeat. This model describes a region of about 63 amino acids that is composed of three repeats of a more broadly distributed family of shorter repeats modeled by pfam01473. While the shorter repeats are often associated with choline binding (and therefore with cell wall binding), the longer repeat described here represents a subgroup of repeat sequences associated with glucan binding, as found in a number glycosylhydrolases. Shah, et al. describe a repeat consensus, WYYFDANGKAVTGAQTINGQTLYFDQDGKQVKG, that corresponds to half of the repeat as modeled here and one and a half copies of the repeat as modeled by pfam01473.
NF033838	PspC_subgroup_1	4.17e-14	40	224	500	680	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.

CAZyme Hits help

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO23193.1	2.54e-78	235	395	2	162
AFC63685.1	8.13e-77	227	394	199	366
QJU15163.1	6.17e-75	231	395	205	369
ADL53623.1	2.43e-72	227	395	192	360
QMW80001.1	1.84e-71	231	395	173	337

PDB Hits help

has no PDB hit.

Swiss-Prot Hits download full data without filtering help

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O51481	1.29e-21	247	396	55	197	Uncharacterized protein BB_0531 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0531 PE=3 SV=1

SignalP and Lipop Annotations help

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001502	0.630414	0.366659	0.000903	0.000271	0.000232

TMHMM Annotations help

There is no transmembrane helices in MGYG000002295_00247.