CAZyme Information: MGYG000002295_00504

Basic Information

• Species: Ruminococcus_C callidus
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_C; Ruminococcus_C callidus
• CAZyme ID: MGYG000002295_00504
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
766	MGYG000002295_2|CGC2	84358.37	4.9455

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002295	2957494	Isolate	China	Asia

• Gene Location: Start: 115380; End: 117680 Strand: -

Full Sequence      

MNIPELLQQLTLEEKASLCSGGDFWHTKAIERLGIPAMMMSDGPHGLRKQDETGDHMGIN
DSIKAVCFPAGCATASSFDRGLVERMGKALGNECQAENVGVLLGPAVNIKRSPLCGRNFE
YYSEDPYVAGEMAASFIQGVQSQQVGTSIKHFYANNQEHRRMSSSSEMSERTAREIYLAA
FERPVRKAKPWTVMCAYNRINGVYAAENKEALTDILRGEWNFHGFVVSDWGAVNDRVADL
ESGMDLEMPSSFGMRDAEIVKAVRCGRLPEAVLDRAVTRILRIVQRYLDGRNPDAVFDRD
ADHELAREIASQCMVLLKNEDHILPLSKTETAAFIGKFAESPRFQGGGSSHINCHKVESA
LEMAADYPVLYAKGYETSDDVVREDLMAEAVAAAKAAKVAVVFAGLPDTFESEGYDREHM
RLPDCQNALIEAVAEANPNTVVVLHGGSPVEMPWLHQVRGVLEAYLCGQAVGGATVQILY
GDVNPSGHLAETFPIKLEDNPSYVAYQGEGDVTEYREGVFVGYRYYTTKKMPVLFPFGFG
LSYTTFAVSNLRTAQDEYQSHDVITVSVDVTNTGDRAGKEVVQLYVLPQTKTDSVQRPVQ
ELRDFEKVELAPHETKTVTFTLHANSAFAYYCTQKKRWVVETGRYLLAAGNSSDHLTTEK
MLTIHGEKALPAEITLNTTIGDVLRIPHADKELEKYAGAFGISSGSSDENAMGESTADMM
EAMMKYMPIRGLLSFGGGEVSIAECKALVEKLNVLLENANLNNRSE

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	28	249	2.3e-70	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	7.69e-86	32	645	101	746	beta-glucosidase BglX.
COG1472	BglX	5.52e-68	22	366	47	388	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	4.14e-56	6	659	56	778	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	2.53e-55	314	523	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	1.18e-33	32	283	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNO18561.1	0.0	1	755	1	758
QUI21624.1	0.0	3	753	2	754
QHQ63232.1	0.0	3	753	6	754
QUA52387.1	2.96e-314	1	753	1	753
QTE73764.1	5.20e-314	1	753	1	759

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	1.34e-274	1	753	3	752	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.31e-193	7	741	9	736	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
3AC0_A	5.29e-135	2	667	5	839	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.57e-131	2	667	5	839	Crystalstructure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
2X40_A	6.70e-120	3	668	4	717	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	5.17e-274	1	753	3	752	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	1.40e-185	7	741	9	745	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	1.25e-183	7	741	9	745	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
A7LXS8	6.34e-134	1	654	44	736	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
P27034	2.17e-133	3	654	2	801	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.992264	0.007722	0.000038	0.000007	0.000005	0.000009

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002295_00504.