CAZyme Information: MGYG000002295_01749

Basic Information

• Species: Ruminococcus_C callidus
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_C; Ruminococcus_C callidus
• CAZyme ID: MGYG000002295_01749
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
483	MGYG000002295_12|CGC1	55495.92	4.8284

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002295	2957494	Isolate	China	Asia

• Gene Location: Start: 12643; End: 14094 Strand: +

Full Sequence      

MSTVRTQNLKNACRALERSTDRTSTWRPVFHLAPVTGWLNDPNGLCQIGETHHIFFQYSP
FDVKPGLNYWGHYTTEDFIHYQYCEPALCSDEKFDCHGVYSGSALGQDGTMYLFYTGNVL
RRDREDYDYTTAGREHNTIRAESEDGLHFTKKTVLLYNEDYPADLTCHVRDPKVWKDGDS
FAMVLGARRKDDVGEVLVYRSDDLKAWTLANRITSQKPFGYMWECPDCFELQGTRFLSFS
PQGVAAEDWKYQNIYQSGYCRLEGDLYGEYTLSAFEEYDHGFDFYAPQTYTDRQGRRILI
GWLGMPDSDYGYPEREFGWANLLTIPRVLHEKNGRIQQEPLPELQQLRGAEQTVVVQQEF
SCRTAAAYEAEIRLTAGKSLRVQFGTDGVLTWDGSFLTLEFGASGCNRPMRQVPLERLKQ
LRLFCDTSSVEIFANEGEAVFTSRFYADAEQSKLTVQAEQAEVHLWEMQPFCVENLFSGG
KQA

Enzyme Prediction     

No EC number prediction in MGYG000002295_01749.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	31	340	1.5e-85	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	1.21e-157	37	333	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	1.80e-140	22	448	9	445	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	3.94e-135	2	468	1	480	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
smart00640	Glyco_32	3.20e-102	31	437	1	437	Glycosyl hydrolases family 32.
pfam00251	Glyco_hydro_32N	7.92e-100	31	340	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CED94068.1	4.33e-147	7	475	9	482
QEH67471.1	3.99e-145	26	468	28	474
AQP38736.1	2.23e-143	30	446	36	455
CBL38537.1	2.23e-143	30	446	36	455
QMW71993.1	9.87e-142	17	482	19	487

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	5.98e-77	28	476	27	488	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
7BWB_A	4.53e-65	26	450	48	464	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	6.66e-64	26	450	48	464	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
6NU7_A	2.28e-58	23	468	29	485	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
1UYP_A	8.11e-51	26	469	2	428	Thethree-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_B The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_C The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_D The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_E The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_F The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	9.32e-95	27	468	29	478	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
P40714	1.32e-90	22	458	20	461	Sucrose-6-phosphate hydrolase OS=Escherichia coli OX=562 GN=cscA PE=3 SV=1
P16553	2.41e-87	7	465	3	467	Raffinose invertase OS=Escherichia coli OX=562 GN=rafD PE=3 SV=1
P13394	1.67e-86	28	463	38	470	Sucrose-6-phosphate hydrolase OS=Vibrio alginolyticus OX=663 GN=scrB PE=2 SV=1
A1STJ9	9.25e-85	26	459	95	527	Probable sucrose-6-phosphate hydrolase OS=Psychromonas ingrahamii (strain 37) OX=357804 GN=Ping_0974 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002295_01749.