CAZyme Information: MGYG000002295_02439

Basic Information

• Species: Ruminococcus_C callidus
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_C; Ruminococcus_C callidus
• CAZyme ID: MGYG000002295_02439
• CAZy Family: GH98
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
574		64999.08	5.034

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002295	2957494	Isolate	China	Asia

• Gene Location: Start: 13; End: 1737 Strand: -

Full Sequence      

MLKTNANWEEACRTYPQNFILEEKYTQPGYIADVESEVYGAYISGYCGNYGIRWDDTGWS
DYPWNGGDLDPQSHEQYRLSTSLPIYFERMAMNGMTVIDGPELVWNDCIKGLWDGTDDEG
YKYRRWDFYDQCKNTNLDLMRKFIDGTIRIPNRKEVIDRTKVVVIQDVDSGSNDDKYCSY
KTLFEGLYRADNDGNYKDNHNPFKSTGRYQTIPTVYGLADDLAKSIPVQINQSTIASRWS
SISDKQAEFNKLYPDSYYANCYVANNQNTWLTYYNNKVSDGDRGAQFNLKYNTCKSLDIK
HQLYGSALINEYSDHINVYLNNYDEDASTTLKTESITIAGASSKPTFTAEDRGVNQTASV
ITESWSNGTYTLTVKHNGPVDISIKCSGNETGRLTSYPQAVQTEPSFPAFYTGARQYEGE
NFDQKNIEENVTNGCRTDVTKFQGMGFVKFGTKDTAAVKDTVKTTKAGVFKWTLRYSATS
DVNCVDLYVNGSKIKTLSLPKGSGYDDWKTISENINLNVGENKIELKANSTLPCSLYIDN
FKVEGDFGDAVITVEPLNGKFIRQHRTIAKRAKI

Enzyme Prediction     

No EC number prediction in MGYG000002295_02439.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH98	1	148	2e-43	0.44036697247706424
CBM35	434	530	1.2e-18	0.8151260504201681

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08306	Glyco_hydro_98M	1.11e-45	1	148	184	328	Glycosyl hydrolase family 98. This domain is the putative catalytic domain of glycosyl hydrolase family 98 proteins.
cd04083	CBM35_Lmo2446-like	3.73e-29	415	543	1	125	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
pfam08307	Glyco_hydro_98C	3.20e-14	153	384	1	267	Glycosyl hydrolase family 98 C-terminal domain. This putative domain is found at the C-terminus of glycosyl hydrolase family 98 proteins. This domain is not expected to form part of the catalytic activity.
cd04082	CBM35_pectate_lyase-like	9.52e-09	437	531	17	113	Carbohydrate Binding Module family 35 (CBM35), pectate lyase-like; appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. This family includes carbohydrate binding module family 35 (CBM35) domains that are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. Included in this family are CBM35s of pectate lyases, including pectate lyase 10A from Cellvibrio japonicas, these enzymes release delta-4,5-anhydrogalaturonic acid (delta4,5-GalA) from pectin, thus identifying a signature molecule for plant cell wall degradation. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. Some CBM35s bind their ligands in a calcium-dependent manner, especially those binding uronic acids.
cd04086	CBM35_mannanase-like	4.45e-08	437	544	17	119	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL18082.1	4.69e-237	1	564	249	810
ADL51037.1	8.21e-233	1	553	238	788
BAV13045.1	8.21e-233	1	553	238	788
ADU21039.1	4.77e-221	1	563	237	802
AOZ99817.1	4.00e-157	1	540	207	738

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WMF_A	1.23e-14	10	384	198	581	Crystalstructure of the catalytic module of a family 98 glycoside hydrolase from Streptococcus pneumoniae TIGR4 (Sp4GH98) in its native form. [Streptococcus pneumoniae TIGR4]
2WMH_A	1.23e-14	10	384	198	581	Crystalstructure of the catalytic module of a family 98 glycoside hydrolase from Streptococcus pneumoniae TIGR4 in complex with the H- disaccharide blood group antigen. [Streptococcus pneumoniae TIGR4]
2WMG_A	3.78e-14	10	384	198	581	Crystalstructure of the catalytic module of a family 98 glycoside hydrolase from Streptococcus pneumoniae TIGR4 (Sp4GH98) in complex with the LewisY pentasaccharide blood group antigen. [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002295_02439.