CAZyme Information: MGYG000002296_01163

Basic Information

• Species: Streptococcus koreensis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus koreensis
• CAZyme ID: MGYG000002296_01163
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
816	MGYG000002296_1|CGC20	90202.79	8.2913

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002296	1965791	Isolate	China	Asia

• Gene Location: Start: 1283301; End: 1285751 Strand: -

Full Sequence      

MKKKDLIFYAGTAVLLAFSTQQVKADEQHASDQTPENTSAVVANTTTSSEAQNTVNEGVG
VKKGVQTENTVATAIAPVTQTVSDNQSSEQVTDEKGSLEQPAPTVVASRAPYGARARVVE
TRNESVPQQESPVSADLNIEKSDSEGTFTITAKNLKGFEGYKEVKIPFWSHANGMKDIVW
YSPTRQSDGSYSVTAKVDDHENASGKYEAQVFYVDYQGRNTFVKKAFVDRAKPSADLSIS
NPDANGNFTITAKNLKGFEGYKEVKIPFWSHANGMKDIVWYSPTRQSDGSYSVTAKVGDH
ENASGKYEAQLFYVDQQGRNTFVKKAFVDRAKPSADITISKNEVEGTFTITAKNLKGFEG
YKEVKIPFWSQANGMKDIIWYTPTRQADGSYTVTAKASDHENADGQYEAQVFYVDAKGQN
KFVKKAFIDFKNQSRLTASLLIQNNNKDTGTFDVIIKDVYSPKGVRTVQVPTWSDRDGQD
DIRWYEATRQSNGDYKVSVKASDHKNSTGKYHIHLYYIQNDGSRVGVGSTTTEVEFRNAQ
TKTQTGIKNVNSGAGTYTVTVDQAPQGRRIKNIRVAAWSKAHQENLFWYSTAPSGMHTEV
QVSTANHQYQSGNYTTHVYVDYVDGGVEGFNLGQTALHPRVTVDQTAFTPRVTNGQRDRV
LRAAASLVGVRSGSAAHHQLVKDYNSVHPLPVGYAVKNSDDWCDVFVTTVFQREGLSGLI
GRECGVERHIQVFKRLGIWNENGASTPKAGDIITFNWDQDYQSNDGWADHIGIVERVENG
LIHTIEGNSGAVGTVKRNVYRIGHGNIRGFATPRYK

Enzyme Prediction     

No EC number prediction in MGYG000002296_01163.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08481	GBS_Bsp-like	2.92e-33	442	530	1	89	GBS Bsp-like repeat. This domain is found as a repeat in a number of Streptococcus proteins including some hypothetical proteins and Bsp. Bsp is a protein of group B Streptococcus (GBS) which might control cell morphology.
pfam08481	GBS_Bsp-like	6.82e-20	340	425	3	88	GBS Bsp-like repeat. This domain is found as a repeat in a number of Streptococcus proteins including some hypothetical proteins and Bsp. Bsp is a protein of group B Streptococcus (GBS) which might control cell morphology.
pfam08481	GBS_Bsp-like	3.19e-18	144	225	7	88	GBS Bsp-like repeat. This domain is found as a repeat in a number of Streptococcus proteins including some hypothetical proteins and Bsp. Bsp is a protein of group B Streptococcus (GBS) which might control cell morphology.
pfam08481	GBS_Bsp-like	2.21e-17	244	325	7	88	GBS Bsp-like repeat. This domain is found as a repeat in a number of Streptococcus proteins including some hypothetical proteins and Bsp. Bsp is a protein of group B Streptococcus (GBS) which might control cell morphology.
pfam05257	CHAP	4.17e-08	743	788	42	83	CHAP domain. This domain corresponds to an amidase function. Many of these proteins are involved in cell wall metabolism of bacteria. This domain is found at the N-terminus of Escherichia coli gss, where it functions as a glutathionylspermidine amidase EC:3.5.1.78. This domain is found to be the catalytic domain of PlyCA. CHAP is the amidase domain of bifunctional Escherichia coli glutathionylspermidine synthetase/amidase, and it catalyzes the hydrolysis of Gsp (glutathionylspermidine) into glutathione and spermidine.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWL83937.1	0.0	132	816	462	1156
AEH56405.1	0.0	132	816	574	1268
AFJ26940.1	0.0	132	816	680	1374
AGY39024.1	3.22e-310	128	640	459	979
AAN64579.1	4.83e-271	113	816	672	1366

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000279	0.999033	0.000210	0.000164	0.000158	0.000139

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002296_01163.