CAZyme Information: MGYG000002296_01165

Basic Information

• Species: Streptococcus koreensis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus koreensis
• CAZyme ID: MGYG000002296_01165
• CAZy Family: GT113
• CAZyme Description: Beta-1,6-galactofuranosyltransferase WbbI

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
350	MGYG000002296_1|CGC20	39441.03	6.8272

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002296	1965791	Isolate	China	Asia

• Gene Location: Start: 1289622; End: 1290674 Strand: -

Full Sequence      

MKYFLKEEFLKDSGARNAGNKARNDVEEIVKREGYQPLLLTVEDWYQMGTVKAQQHKAKA
LAQAFSQLKSGDQLLIQFPMLHHSFFTTRLVRKIQRRGVQVYFIIHDLEALRYANLDTVP
LKHKIRVHLQESSLLKVADGVIAHNPIMKSVLVEKGIPEHKLVSLEIFDYLIPNYQEKDG
LSKDQPIIVAGNLAQEKAGYLYQLPARPAYNLYGVGFDESRALANETYFGSFLPDELPAA
LEGGFGLVWDGDSAETCSGVFGEYLRYNNSHKASLYLASGFPLVVWKQSALSHFVLEKGC
GIAVESLHDLKETIDNLSDADYQDLVDNAKRVGQEIRDGHYLKTALKHLS

Enzyme Prediction     

No EC number prediction in MGYG000002296_01165.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT113	15	349	1.4e-104	0.9720496894409938

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09814	PRK09814	3.43e-100	16	347	14	327	sugar transferase.
cd03794	GT4_WbuB-like	6.75e-11	96	319	121	361	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
COG4559	COG4559	0.001	54	129	141	221	ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGY39025.1	2.21e-254	1	350	1	350
VED68038.1	3.29e-238	1	349	1	349
VEE18982.1	3.29e-238	1	349	1	349
AGY40483.1	1.40e-223	1	349	1	349
QXW96744.1	4.30e-220	1	349	1	348

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37749	1.78e-44	16	349	12	323	Beta-1,6-galactofuranosyltransferase WbbI OS=Escherichia coli (strain K12) OX=83333 GN=wbbI PE=1 SV=1
Q9AEU1	1.71e-19	22	346	20	325	Glucosyltransferase 3 OS=Streptococcus gordonii OX=1302 GN=gtf3 PE=3 SV=1
B3XPQ7	3.31e-15	22	346	20	325	Glucosyltransferase 3 OS=Limosilactobacillus reuteri (strain DSM 17509 / CIP 109821 / 100-23) OX=349123 GN=gtf3 PE=3 SV=1
F8KEJ1	7.15e-14	22	346	25	330	N-acetylglucosaminyltransferase OS=Limosilactobacillus reuteri (strain ATCC 53608) OX=927703 GN=gtf3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002296_01165.