CAZyme Information: MGYG000002296_01390

Basic Information

• Species: Streptococcus koreensis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus koreensis
• CAZyme ID: MGYG000002296_01390
• CAZy Family: GH8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	MGYG000002296_2|CGC2	42709.55	7.82

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002296	1965791	Isolate	China	Asia

• Gene Location: Start: 114714; End: 115817 Strand: -

Full Sequence      

MRTKKMKYLWFVVILAVFCLTLFLARSRSKVEMRNRLYRQWTEHYLVTDGKQSYVRTTNS
DQETVVLSEAQGYGMLITVEAAKKDLANQEDFDRLYRYYQNNRFDDTQLMAWKQIIKKGK
LSSEHQNATDGDLYIAYALMEAAKQWPEKGDVYQKQAKAILEDILKYNYNEKTGVLTVGN
WADQNSEFYHLMRTSDTLPSFFQSFYELTGNERWLSIKEKMLAQLDAISSQSKTGLLPDF
MWVDEQGARVADPDTIESKYDGAYSYNACRLPYNLAQSQDKTSQKLVKKMLDFFMKQRKI
YAGYDLKGNALHQYQAASFIAPVSYAAENGDGYLKLVQQNKFIFMQDLSTDNYYDATMTT
MIALQLF

Enzyme Prediction     

No EC number prediction in MGYG000002296_01390.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	37	364	2.5e-72	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01270	Glyco_hydro_8	1.52e-25	38	364	8	317	Glycosyl hydrolases family 8.
COG3405	BcsZ	6.06e-25	5	359	1	337	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
PRK11097	PRK11097	9.55e-08	37	166	27	150	cellulase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYF93492.1	1.94e-268	1	367	1	367
AGY40742.1	1.57e-258	1	367	1	367
AGY37425.1	1.57e-258	1	367	1	367
SQH65600.1	1.57e-258	1	367	1	367
VEE18714.1	1.23e-255	1	367	1	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XD0_A	4.52e-39	41	327	69	364	ApoStructure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4],5XD0_B Apo Structure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4]
1V5C_A	2.40e-28	38	322	35	335	Thecrystal structure of the inactive form chitosanase from Bacillus sp. K17 at pH3.7 [Bacillus sp. (in: Bacteria)],1V5D_A The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)],1V5D_B The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)]
7CJU_A	2.76e-28	38	322	41	341	Crystalstructure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7CJU_B Crystal structure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7XGQ_A Chain A, chitosanase [Bacillus sp. K17-2],7XGQ_B Chain B, chitosanase [Bacillus sp. K17-2]
6VC5_A	1.23e-11	35	286	2	241	1.6Angstrom Resolution Crystal Structure of endoglucanase from Komagataeibacter sucrofermentans [Komagataeibacter sucrofermentans]
1WZZ_A	8.18e-09	68	272	48	242	Structureof endo-beta-1,4-glucanase CMCax from Acetobacter xylinum [Komagataeibacter xylinus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19254	1.28e-38	41	327	69	364	Beta-glucanase OS=Niallia circulans OX=1397 GN=bgc PE=3 SV=1
P29019	6.79e-28	38	322	91	391	Endoglucanase OS=Bacillus sp. (strain KSM-330) OX=72575 PE=1 SV=1
P37696	1.91e-09	68	272	56	250	Probable endoglucanase OS=Komagataeibacter hansenii OX=436 GN=cmcAX PE=1 SV=1
P27032	1.42e-06	41	283	30	256	Minor endoglucanase Y OS=Dickeya dadantii (strain 3937) OX=198628 GN=celY PE=1 SV=1
P18336	2.07e-06	68	272	52	245	Endoglucanase OS=Cellulomonas uda OX=1714 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.937517	0.050469	0.010817	0.000205	0.000136	0.000887

TMHMM  Annotations     

start	end
7	25