CAZyme Information: MGYG000002297_00642

Basic Information

• Species: TF01-11 sp001916135
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; TF01-11; TF01-11 sp001916135
• CAZyme ID: MGYG000002297_00642
• CAZy Family: GH3
• CAZyme Description: Xylan 1,4-beta-xylosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
174	MGYG000002297_4|CGC2	19399.71	4.2832

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002297	3127107	Isolate	China	Asia

• Gene Location: Start: 113704; End: 114228 Strand: +

Full Sequence      

MSDNNTNRNNPLWDTGKTMEERLDYLVEELTLEEKFSCLGTGNPAIERLGIPSFFVGCEG
AHGLQMRHDQSFDQGEPQPTTIFPNPIGMSGTWDPELIQKAGEVVGTEARAVFEKDGRRG
GLCLWAPTIDMERDPRWGRTEEAYGEDPYLTGKMASAIFAGCGEKEIIYVVELH

Enzyme Prediction     

No EC number prediction in MGYG000002297_00642.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	45	169	1.2e-31	0.4861111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	2.24e-24	44	157	53	151	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	5.75e-24	6	157	36	182	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	1.72e-22	48	171	63	169	Glycosyl hydrolase family 3 N terminal domain.
PRK15098	PRK15098	4.29e-22	48	155	101	185	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABX43682.1	2.88e-67	11	170	10	168
CBL12929.1	1.37e-61	8	170	9	170
CBL10090.1	1.37e-61	8	170	9	170
VCV20176.1	1.37e-61	8	170	9	170
BBF45253.1	6.27e-57	10	170	3	162

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VC7_A	3.88e-20	22	161	25	165	ChainA, xylan 1,4-beta-xylosidase [Phanerodontia chrysosporium]
7VC6_A	3.88e-20	22	161	25	165	ChainA, xylan 1,4-beta-xylosidase [Phanerodontia chrysosporium]
5WAB_A	9.96e-18	19	167	1	148	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
7MS2_A	6.32e-17	26	161	8	141	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5TF0_A	8.59e-17	48	161	80	170	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EY15	3.26e-24	11	161	23	171	Xylan 1,4-beta-xylosidase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyl3A PE=1 SV=1
Q9LXD6	1.10e-23	16	166	53	201	Beta-D-xylosidase 3 OS=Arabidopsis thaliana OX=3702 GN=BXL3 PE=1 SV=1
Q5ATH9	2.78e-23	11	161	37	186	Exo-1,4-beta-xylosidase bxlB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bxlB PE=1 SV=1
A5JTQ2	3.79e-23	14	161	56	201	Beta-xylosidase/alpha-L-arabinofuranosidase 1 (Fragment) OS=Medicago sativa subsp. varia OX=36902 GN=Xyl1 PE=1 SV=1
Q0CB82	8.28e-22	10	161	40	190	Probable exo-1,4-beta-xylosidase bxlB OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bxlB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002297_00642.