CAZyme Information: MGYG000002297_01315

Basic Information

• Species: TF01-11 sp001916135
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; TF01-11; TF01-11 sp001916135
• CAZyme ID: MGYG000002297_01315
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
485	MGYG000002297_10|CGC1	56553.2	4.832

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002297	3127107	Isolate	China	Asia

• Gene Location: Start: 49312; End: 50769 Strand: -

Full Sequence      

MTPQQKYLDIVDEVIAKGPFKPDWVSLSDYETPKWLKNGKFGIFIHWGLFSVPAFNNEWY
SRNMYIQSMEEWQHHRDTFGEHTKFGYKDFIPMFTAPKFQPEEWVKLFKEAGARYVMPVA
EHHDGFQMYDSEISEWNSVKMAMKRDVLGEMKAAIEKEGLTFCESNHRVEHSFFMGHGKE
FDSDIKDPMKLGDFYYPAMPEPDNQDLFSPAPPQDFMEDWLARNCELVEKYHPNMVYFDW
WIQHDSVKPYLKKFAAYYYNRGLEWGQQVTISYKHDAMMLGTGVLDMERGHFAEAKPFTW
QADTSMAYNSWCYTEQNRFKPTVEIIQDLVDIVSKNGCLLLNVGPKADGTICDEEIKILK
EMGEWMSVNGEAIYDTHPWRIQAEGSTKGVEGMFSEEGRQAYGKDDIRFTCKADYIYIIA
MKQEGADVVVKSMGEDSKDFHGIILEMKALGYDEPVTYERDADTMTIHAPFVQSDMPVVY
RMKLK

Enzyme Prediction     

EC	3.2.1.51

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	13	375	3.7e-108	0.9393063583815029

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00812	Alpha_L_fucos	1.04e-130	15	390	2	354	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
COG3669	AfuC	1.62e-115	46	421	1	367	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam01120	Alpha_L_fucos	2.45e-115	15	371	1	333	Alpha-L-fucosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANW97614.1	3.39e-223	4	484	3	489
AGI38208.1	3.39e-223	4	484	3	489
ANX00174.1	3.39e-223	4	484	3	489
AGC67128.1	3.39e-223	4	484	3	489
QNU68446.1	3.26e-218	6	485	3	488

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LJJ_A	2.49e-121	1	485	21	511	ChainA, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LK7_A Chain A, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135]
7LNP_A	1.40e-120	1	485	21	511	ChainA, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LNP_C Chain C, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LNP_D Chain D, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LNP_E Chain E, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135]
4NI3_A	4.77e-68	16	484	3	489	ChainA, Alpha-fucosidase GH29 [Fusarium graminearum],4NI3_B Chain B, Alpha-fucosidase GH29 [Fusarium graminearum],4PSP_A Chain A, Alpha-fucosidase GH29 [Fusarium graminearum],4PSP_B Chain B, Alpha-fucosidase GH29 [Fusarium graminearum],4PSR_A Chain A, Alpha-fucosidase GH29 [Fusarium graminearum],4PSR_B Chain B, Alpha-fucosidase GH29 [Fusarium graminearum]
1HL8_A	2.76e-57	14	469	2	446	CrystalStructure Of Thermotoga Maritima Alpha-Fucosidase [Thermotoga maritima MSB8],1HL8_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase [Thermotoga maritima MSB8],1HL9_A Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With A Mechanism Based Inhibitor [Thermotoga maritima MSB8],1HL9_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With A Mechanism Based Inhibitor [Thermotoga maritima MSB8]
1ODU_A	5.39e-57	14	469	2	446	CrystalStructure Of Thermotoga Maritima Alpha-Fucosidase In Complex With Fucose [Thermotoga maritima MSB8],1ODU_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With Fucose [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P17164	8.67e-51	15	384	28	376	Tissue alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca1 PE=1 SV=1
Q99LJ1	1.00e-48	13	384	14	366	Tissue alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca1 PE=1 SV=1
Q60HF8	1.92e-48	20	402	39	398	Tissue alpha-L-fucosidase OS=Macaca fascicularis OX=9541 GN=FUCA1 PE=2 SV=1
P04066	4.96e-48	20	402	37	396	Tissue alpha-L-fucosidase OS=Homo sapiens OX=9606 GN=FUCA1 PE=1 SV=4
P48300	2.50e-46	20	402	37	396	Tissue alpha-L-fucosidase OS=Canis lupus familiaris OX=9615 GN=FUCA1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000021	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002297_01315.