CAZyme Information: MGYG000002297_01642

Basic Information

• Species: TF01-11 sp001916135
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; TF01-11; TF01-11 sp001916135
• CAZyme ID: MGYG000002297_01642
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
915		101709.95	8.4859

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002297	3127107	Isolate	China	Asia

• Gene Location: Start: 40705; End: 43452 Strand: -

Full Sequence      

MKKGINRVKMGIKALVGVIGGYLGVISTILGTMLGIMASILVVCLIAGICVYVKVIPMFT
EAREVVFDNLVNMTEEDFVMNEDTQVFDDKGNKIGSVNAGRFKYTKISKISPYIYNGYIA
VEDKRFKTHGGVDLLATMRASVALLKNRGAITQGGSTITQQVIKNNLLSQEQTFTRKVAE
ILLAPSVEQKFGKDKIMEFYCNSNYYGNRCYGVASASKYYFGKKPADLEPAEAALLIGLS
NSPAAYNPVAHPKEAKQKRNDVLLKMYEGGAITQKEYKKAVKTKLEVLQLMEKTSNESYL
LSYAVHCAALSLLEKENFEFKYTFKNKKEYENYQAEYASVYSAKCDDIRSGGYKLYTSLN
QKKQKKLQAAVDSGLAYNTEKNADSGKYALQGAAVCVDNNTNYVVAVVGGRGTKDAYNRA
YLSARQSGSSIKPLIDYAPGFESGQFSPSTVVNDHAIKNGPKNSGGGYRGNVHIREAVAR
SINTIAWQVLEAITPEYGLSFLDKMHFHNLSYVDNGNMALSLGGFTEGVRVVDMAKGYAT
LANNGEYSDRTCIKKISHVSDGVIYKDAEEKTQVYSKGAAWIMTDVLKGVFNESYGTARA
LKLNGGQITAGKTGTTNSSKDVWFCGYSAYYTTVVWCGYDTPRAMPGTYGATLSGAIWKN
YMNQIHQDLPPKDFEKPDTVCLAKYDSKGNIIEGTEVTGDRKRSYGMDYFATDILEDTTE
YVDNETDQSRQNKARSKLEKFEKMTITSIADYYTFTETYNTLKNMIAVIKDDDVRKEYST
RCKDKYDSLKDESVKWKDVVKAYEEQRSEENTRLAEEAAAKAKEERETQTRKTRIALAQT
RIKKLAGYDSQPSNVKDLLEKAEQAVEACKSYSEYNTLHSDYIRSRQKLLALPKEGDPTS
GQSDTDSGTDNSDTE

Enzyme Prediction     

No EC number prediction in MGYG000002297_01642.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	91	267	1.4e-57	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	1.94e-158	104	668	4	531	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	3.83e-156	34	678	17	609	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	3.01e-133	29	732	4	775	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
TIGR02071	PBP_1b	2.14e-81	113	702	158	717	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG4953	PbpC	6.65e-77	84	677	37	571	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJU21747.1	9.35e-263	51	895	52	880
QIX92626.1	9.35e-263	51	905	52	890
QRP41393.1	1.87e-262	51	895	52	880
ASN93939.1	1.87e-262	51	895	52	880
QQQ98855.1	1.20e-260	51	905	52	890

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OON_A	7.46e-60	85	686	22	743	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3DWK_A	3.81e-56	85	680	9	602	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
3UDF_A	4.13e-56	109	670	46	720	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]
3ZG8_B	5.67e-55	187	640	3	433	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
2OLU_A	7.61e-54	85	680	18	611	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A5I6G4	5.21e-79	82	738	55	714	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=pbpA PE=3 SV=1
A7FY32	5.21e-79	82	738	55	714	Penicillin-binding protein 1A OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=pbpA PE=3 SV=1
A7GHV1	8.77e-78	82	738	55	714	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) OX=441772 GN=pbpA PE=3 SV=1
P40750	3.51e-76	72	659	44	617	Penicillin-binding protein 4 OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpD PE=1 SV=2
P38050	1.71e-75	75	640	40	571	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.996798	0.003201	0.000007	0.000004	0.000003	0.000008

TMHMM  Annotations     

start	end
21	53