CAZyme Information: MGYG000002299_00572

Basic Information

• Species: Vagococcus sp003462485
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Vagococcaceae; Vagococcus; Vagococcus sp003462485
• CAZyme ID: MGYG000002299_00572
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
266	MGYG000002299_1|CGC4	30758.84	6.9655

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002299	2039592	Isolate	China	Asia

• Gene Location: Start: 552009; End: 552809 Strand: -

Full Sequence      

MLKVIDLSNHQRGMSLDTLKADAFIFKATEGTYFIDDTCDTFVQQAKKLNKPYGVYHFLD
QNDVIKQADFFLTHIKGYLGEAILVLDYEEYGKQGAQKAKEFLDYVYKQTGVKPLIYMNE
SDANSDDWLDVVAGDYGLWVAKYSQNTPVVKQWPSYAMWQYTSTPVDTSYFYGDKLAWQQ
YAAPKKTIAQQKEDYHTTGTRFEALRTLVIQADESFKKASGMHFSKSTVFDIEQICHTKT
TTHACILYNHRKVFVTLHKDYVRKID

Enzyme Prediction     

No EC number prediction in MGYG000002299_00572.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	5	164	5.7e-38	0.96045197740113

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06417	GH25_LysA-like	2.38e-49	2	178	1	195	LysA is a cell wall endolysin produced by Lactobacillus fermentum, which degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. The N-terminal glycosyl hydrolase family 25 (GH25) domain of LysA has sequence similarity with other murein hydrolase catalytic domains while the C-terminal domain has sequence similarity with putative bacterial cell wall-binding SH3b domains. This domain family also includes LysL of Lactococcus lactis.
cd00599	GH25_muramidase	1.87e-39	3	171	1	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	4.49e-34	5	166	1	176	Glycosyl hydrolases family 25.
cd06525	GH25_Lyc-like	1.67e-32	3	164	1	169	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd06524	GH25_YegX-like	1.32e-25	5	173	3	194	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APB31733.1	3.43e-193	1	266	1	266
QNN73753.1	2.39e-126	1	265	1	262
QIL47414.1	7.67e-125	1	266	1	263
ASV81999.1	1.59e-61	2	186	3	187
QQY21739.1	5.30e-60	2	186	3	187

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002299_00572.